Identifiers and Description

Gene Model Identifier

Contig22174.0.g18

Standard Name

EIF5

Aliases

Contig22174_0_g18

Description

Domain found in IF2B/IF5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001492901.9993430003514377e-39Domain found in IF2B/IF5 famil
y protein
SGDYPR041W7.998167219297731e-26TIF5 SGDID:S000006245, Chr XVI
from 648704-649921, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22174.0.g18(coding)
ATGACCGCTAGAGTAAACATCCCATCATACATCCAGGACCCGAGTTATAGGTACAAAATG
CCTAAAATGGTCTTGAAGCAAGAAAGCAGACTTAATGGAGTGAAGACCAACATATTCAAC
TTAGATGAGATAGCTAAGGCACTCAGAGTACCAGAGGAAGCTATCATGAAGTTTTGGTGC
GCTGAGTTGGGAGCCAGCTCTGAAAAAAAGAGCATCGTTAAAGGTCAACATAACTTTGAG
ACACTTTAAAAAATTCTAGACAAATTTATTGAGAAGTATTTGCTTTGTAACAAATGCAAA
TATCCTGAAACCTCCATGTACATCAAGCAGAAGAGCTTGCAATCAAAGTGCAGAGCTTGC
GGTACAATCAACAACCTCGATAGTATGCATCGTTCAGGCATCCAGCTTATGAAGCAGTTG
CCCAAGAACATGAGTGAAATCGATGGTAATAAAAACGATGCTGACAGTGAAGTCGGCAAG
AAAACAAAGAAGAACAAGGACGAGGAAGAAAACGGCAAGATTGAGGAAGTCCCTGACAAA
AAGAAAAAGAAGGATGAACAGCTCACCACTGCTGTAGAAGAGACTACTGTCGACTCTGAG
GAAGTTCTTTCCGTTATCGAGAAAGTTTCTAACATTGTGAAAGAGGGAGCTACTCCAGAG
ATTATTCTTGAAGAAACTTAAAAGACTTTGGTCTCACTTGGTCTCTCAAATGAATTCCGC
TACTACACTCTTATGTGCGGTATCTTCACTCCTGATCGCAACATTGTTAAGAACTGGCCA
CAGTACGAAAAGATATTCTTGAGTTTAGTTGCTCAGGATGGAAAGATCGGCATCAAGCAT
CTCTTCCAATCTATCATTCAACTTTTCATGATCAAACACCCAGATCTCCAAAAGTATGCC
GCTACTTTCATGAAGCTGATTTATGATCAAGAAGTCTTCGATGTTGAACTCATCATCGGT
TGGTTTGACAAAAAAGTTAAGCTCGATAAAACTTGTGCTCTCTACGACAGAAAGGCTGAA
AGACACTTCAGAAAGCTTATCGTCTAATTTGTCGATTGGTTGAGAAACGCTTAAGAAGAA
GAACCTGATGAAGAAGAGGAAGAAGAAGAGGAGGAAGAGGAAGAAGAGAAGCAATCTTCA
ATCTCTCCTTCAAAAGCACAAACAGAGGAGTCTGAGCAAGTCAGAAAGCAAAAAGAGCTC
ATCCAAAAGCAAATGCAAGAGCAACAGAAGATGATTGAGCTCAAGAAAGAAGAGGCTTTA
AATAAAGCTCTCACTGAGACTCAAGACAAAGTCAATGTAATGGACATTAACGTCGATGAC
GACTTCGATATTGATGATATTTGA


>Contig22174.0.g18(protein)
MTARVNIPSYIQDPSYRYKMPKMVLKQESRLNGVKTNIFNLDEIAKALRVPEEAIMKFWC
AELGASSEKKSIVKGQHNFETLQKILDKFIEKYLLCNKCKYPETSMYIKQKSLQSKCRAC
GTINNLDSMHRSGIQLMKQLPKNMSEIDGNKNDADSEVGKKTKKNKDEEENGKIEEVPDK
KKKKDEQLTTAVEETTVDSEEVLSVIEKVSNIVKEGATPEIILEETQKTLVSLGLSNEFR
YYTLMCGIFTPDRNIVKNWPQYEKIFLSLVAQDGKIGIKHLFQSIIQLFMIKHPDLQKYA
ATFMKLIYDQEVFDVELIIGWFDKKVKLDKTCALYDRKAERHFRKLIVQFVDWLRNAQEE
EPDEEEEEEEEEEEEEKQSSISPSKAQTEESEQVRKQKELIQKQMQEQQKMIELKKEEAL
NKALTETQDKVNVMDINVDDDFDIDDI