Identifiers and Description

Gene Model Identifier

Contig1838.0.g75

Standard Name

EIF4Gc

Aliases

Contig1838_0_g75

Description

MIF4G domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012434700.000000019990673443141236MIF4G domain containing protei
n
SGDYGR162W0.00000006998394348458725TIF4631 SGDID:S000003394, Chr
VII from 824059-826917, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1838.0.g75(coding)
ATGAAGTCTAATTAGACTAACCAATAATTTAATCAATCTGTTGGATCCCAGCTTCATGTA
GATGGTTCCGCAGCCTAAAATTAACATATGGGAATTCAAGGAAGCATGCAAATAAGGTAA
AACGTGACACACCCTGAATTTCATCCATAGTCTCATGGACAATAATCTCATAATTTGAGC
TAAACAAATAGCACTAATTCTAGTTCCGAAGCCAAAAATACCTTCAACACAACTTCTTCA
GAATTTGTGCCGATTAAGAAAGCTGGAGGATAAATGTCTCAGTAAAACTTGAATATGTCA
GGAAATGTAGGAAATTTTGGCGGTTTAGCTCCAATAAACAATGCTTAAATGCAAGGCCAA
AATCCAGGATATCATTAATAGAGTCCATAGTTTTACCCATAAGGAATGCAACCTTAGATT
AGCTAAAATCAATATAGACCAAGTAATTTATGCCTAAATGTTAATTTACCTTTAGATATG
TACAATTAGCAGCAGCCACAGTATAACCAACAGTATGGAATGAACCCACAGATGAACCAC
TCCCCTTATACGCCTCAGCACCATATGGCAACTCATTTCAATCAATAAATGCATATGCAA
CAGCCTCATGTCTTGCCTATGCACTATTAAGGGGCACCTTAATTCAACTAATAGTAGTTC
CATCCAGCTCAACAATAGCAACAACCCTAAATGAATTAGAACTTTTAGAACTTTAACAAG
CCTCCACCAGGTTTGAATCACCCTGTGGGTTTCGCAGGTGGGTTAGCCTAAACATAAACT
TTTCCAGTTGGGTCATTTAGTTAACCTTTTATCCCAACAAATAAAGGCAACTAGGTTGGA
GGAATAGGATAAACTATGTCTGCAGACTAGCCTCATATGAAATCATAAACTCATTAATTA
GATACTTCTTCGAGTAATCCTTCTATGAAGATCTAAGAATTTAACTCTTCAGCACCCCCT
AAACAAACCTTAGTTTAAACTTAGAGCACAGGCCATGTTTAATCTTCTAATTCTTTAAAT
CTGAGCTAGACAACATCAGCGTCTAAACTGCCAAAGATTGAAACTTTCAATCTCTCATAA
AAGGGCTTTGCCCTATTTAAGTGCTCATAAAGCAAAGCTTATAAGAGAGAGGATTTTGTC
GTAAAGAATGAAGTGGTAAAGAATGAAATTATTCCTAACTTAAAATTGTCTGTACCCTCA
TCATCTAGTGAAAAGAACAAAGAGTTAGAGAACAAAACTAGTCTCTAGCAATAGGAGCTT
AAAGAGAGTGTCGCAAGTATGGATGTTAGCTCATAAATATTTAAACCAACCAAGATGCCA
AGTAGCTAGCCAAGACCGTAAACTCAAAATGAGAAGCCTTTTTATGCTAATTAATAACAA
ATGATCCAAAATTAAAACAAAAATTTCAAGGCTCCTTAATAAGTAGCACCTAACATGGTC
TACCCTAACTACGCAAATCAATATTCATATTAATAATAGTATAGACCTCCTGGTCCATAA
TATCCAGCTTAATATCCTCCACATATGAATTAAGTCTTAATGGGCATGCCAAACTAAATG
TAATAAGTTCCTTAAAATTACATCCCAGGCTAAAATTTCTAACCATATTAAAACTTGATG
CCCTAATAAAATTAGCAATTCTAATAGAACCAACCTCACCAGATGAATCATATTCCAGGA
GCGAATGTGTAACAGCCATAAGACCAATTTTAAGGAGGTATACCATAACAACATTTGGTT
AATCCAATGATGCAATAGCATTAAGTCAATGCCTTCCAAGCACCAAATGCTCAATAAATT
CCTTATAATTAGCAATAACACTTAGCTTAAGATTAACACTAATCGCATTTAAGCCCAAGT
AAACTGGTAGAAGTTGTACCTCAACCAATTTAGCAAGTTATTGAAGACAAAGTATAAGAA
GTTGTTAAAGTGTAGGAAGTTGTTCAACCTGTAATTGAACCAAAACAAGAATCTCCAATT
AAACAAATTGAAGTAGTTAAAGATAAGTTTTAGTCAGCTGCAGATGCACTTAACATATAA
GATGATGAAGTTGCCAAAATTTAAGAATTAATTAAGGAGATTAAACAGTAAGCTCAAGCT
AAGATAACACTAGATATCTTAAAGAAGTTTAAGGAATTGAGTGTTTGCTAAAGAGTACCT
CCTTTCTTCCATAGAGAGATTTTGGATAGATAAGTCATCGTCAAAGAACTTGAAGCTAAT
GCTAAAAGAGGAGGACATGGTGGTGGGAGAGGTCACCCTCATGGAGATAGAGGTGGTCAT
TAAGGCAATTATAGAGGCAGAGGAAGAGGCTAAGGAGGGCATTAAAATCGTGATAGATCC
CCTGGAAGTCAATTTGATAAGGGCACTCTCAAGTAACAGAGAGAAAGAGAAGAGGCAATG
ATAACACCTCTTCAAAGAGCATAAACCGATGAACTTCAATAAAAACTAAAATTAGAAAGT
AAAATTGCTATAGATAAAGCTAGAGGTGATAAGGATGTCATTCAGTAAATAAGACTTTGT
GTAAACTTAATGACTCCAGACAATTTTGACAAGAAATTCGATGAGCTTAGAAACCACATG
TTTGGTGAGCTTAAATACCCTGAGGAACCAGGATTTAACCCTGCTGTAGATCTACCTCTA
ACAGAACAACTCAATGATACTAATATGAATTTAGTAGTTGAGACTATCTTCAGAAAGGCT
TAGAAAGAGAAGTCATATCTGATGTTCTATGGTGATTTATGTGAAAGAATTATCAGACTT
GAAATGAATCTAAGATAAATGAAGTCAACAAAGAGAAACATTTAAAACAGTAACTTTAGA
AAGACTCTCTTAGACCACTGCAAATCAAGTTTTGACTAATTTTTCATGTAAGATATTCAA
GAAAAGAGAAAAACTATGGATGAGGAGCAATAGTTCAAATATAGACAACTTCTTTTTGGA
AATATTCAATTTGTTGGTGAGCTAAACAGAAGACATTTGCTTAAAGAGACAATTATTATC
TCAGTTTTTGACTTGCTTTTGGCAGTCGATACTCCCTCACAACTTCAGTATGTGAATGAT
GATACTGTTGAAGGAGCAACTGTATTGATGGAGAAAATTGGTCACTTAATCGAGGATATT
ATTTCCAAGGGAGCTCTACCCGAAGGCTAAGAAGCTACAAAGACAGTCGAAAAACAATCA
CAAGCTTTCACTCGCATCTTCAAGAGATTTGAGGAGGTAGAAAACGATGAGAGGATTTCA
TTAAGAATAAGAATTCTAGTCAAGAATATGCTTGAAAACAGAGCCTAAGGATGGGAGAAA
ACTAAAAAACAAAACGAGGGAGGTCCAAAGAAAATCGATGAACTGAGGAAAGAGCTTGAA
GCTAAAGCCAGAGAAGAGGATAGAATAAGATAGATTATCGAAATGGAAGAGAATTAGCAT
AGAGATCAGAATAGAGGGTATAGAGATAGAGCTAATACCTAAAATTATAAAGGCAAGCAA
GGTGGTGATTTCAAGCAGTATGACAGCACCTAGTAGAATAATAATAATAGGGGAAGAAAT
TCAATAAAGAGTGGATCAGGTCGTGGAACTGATTTGAAAAGTTCTCAAATGCAATAAAAT
TAAGGATCTAATTAATATATCAAGAAACAAGCCTCAATGAATACATAATTTGATTCAACT
ATAAAGGAAGTTGCTAAAATAGATGATAAGGAAGTAGCAAAGAGATGCGTTGATAATATA
TAAGACTTCCATAACATTCATTAAAACATTCCTACTGAACCAGTTAAGACTTACGACAGA
AGCAATTTCTTCCAGTTATACATAGACTTGCAATAAATCAATGGCAGAAAAGGCGAAGAA
ACACTTTTCTTATTCTTGAACTAACTTTATGATGGAAATGAATTACTTATCGAGAAATCT
CTCGCAAATTACATTTCGGAACTTGCCCTGAGCAAAGCCTTATCAAGTTCAGCAATTGCG
AAAGGGTTGAGTTAGTTAATCAATCAACCACCTGACAATGCCCTTCTCGAGTCATCCCTC
GCAGAAATCTTCGACTTATTAATAGAAAATAAGATATTGAATATGAATGAAATCACTTGG
CCAAAACCTTCAGCCTCAGAAGACGAGGATGTCGTATTCGTCGAAAGCAACTATAAAATG
ATGGCTCAATTGCTTCTTAAAGTCAAATCGAGAAGAGGAAACTCATGGAAAAGTGTTTTT
GACTTCTTCTATAAAAATGAGCTAGACAGAGCAGTAAAGCAAATGTCAACTTTAATTTTG
GAGGATAACTTATTCGCAGACATTAAAGATTAATTGGGTGCTGAAGATGCTAAATATATT
CTTCCACTTCTGGAACAAAACGAAGAAGAACTTGCTAAAGTAAAAGCTTCAATTAAGTGA


>Contig1838.0.g75(protein)
MKSNQTNQQFNQSVGSQLHVDGSAAQNQHMGIQGSMQIRQNVTHPEFHPQSHGQQSHNLS
QTNSTNSSSEAKNTFNTTSSEFVPIKKAGGQMSQQNLNMSGNVGNFGGLAPINNAQMQGQ
NPGYHQQSPQFYPQGMQPQISQNQYRPSNLCLNVNLPLDMYNQQQPQYNQQYGMNPQMNH
SPYTPQHHMATHFNQQMHMQQPHVLPMHYQGAPQFNQQQFHPAQQQQQPQMNQNFQNFNK
PPPGLNHPVGFAGGLAQTQTFPVGSFSQPFIPTNKGNQVGGIGQTMSADQPHMKSQTHQL
DTSSSNPSMKIQEFNSSAPPKQTLVQTQSTGHVQSSNSLNLSQTTSASKLPKIETFNLSQ
KGFALFKCSQSKAYKREDFVVKNEVVKNEIIPNLKLSVPSSSSEKNKELENKTSLQQQEL
KESVASMDVSSQIFKPTKMPSSQPRPQTQNEKPFYANQQQMIQNQNKNFKAPQQVAPNMV
YPNYANQYSYQQQYRPPGPQYPAQYPPHMNQVLMGMPNQMQQVPQNYIPGQNFQPYQNLM
PQQNQQFQQNQPHQMNHIPGANVQQPQDQFQGGIPQQHLVNPMMQQHQVNAFQAPNAQQI
PYNQQQHLAQDQHQSHLSPSKLVEVVPQPIQQVIEDKVQEVVKVQEVVQPVIEPKQESPI
KQIEVVKDKFQSAADALNIQDDEVAKIQELIKEIKQQAQAKITLDILKKFKELSVCQRVP
PFFHREILDRQVIVKELEANAKRGGHGGGRGHPHGDRGGHQGNYRGRGRGQGGHQNRDRS
PGSQFDKGTLKQQREREEAMITPLQRAQTDELQQKLKLESKIAIDKARGDKDVIQQIRLC
VNLMTPDNFDKKFDELRNHMFGELKYPEEPGFNPAVDLPLTEQLNDTNMNLVVETIFRKA
QKEKSYLMFYGDLCERIIRLEMNLRQMKSTKRNIQNSNFRKTLLDHCKSSFDQFFMQDIQ
EKRKTMDEEQQFKYRQLLFGNIQFVGELNRRHLLKETIIISVFDLLLAVDTPSQLQYVND
DTVEGATVLMEKIGHLIEDIISKGALPEGQEATKTVEKQSQAFTRIFKRFEEVENDERIS
LRIRILVKNMLENRAQGWEKTKKQNEGGPKKIDELRKELEAKAREEDRIRQIIEMEENQH
RDQNRGYRDRANTQNYKGKQGGDFKQYDSTQQNNNNRGRNSIKSGSGRGTDLKSSQMQQN
QGSNQYIKKQASMNTQFDSTIKEVAKIDDKEVAKRCVDNIQDFHNIHQNIPTEPVKTYDR
SNFFQLYIDLQQINGRKGEETLFLFLNQLYDGNELLIEKSLANYISELALSKALSSSAIA
KGLSQLINQPPDNALLESSLAEIFDLLIENKILNMNEITWPKPSASEDEDVVFVESNYKM
MAQLLLKVKSRRGNSWKSVFDFFYKNELDRAVKQMSTLILEDNLFADIKDQLGAEDAKYI
LPLLEQNEEELAKVKASIK