Identifiers and Description

Gene Model Identifier

Contig8820.0.0.g16

Standard Name

EIF4Gb

Aliases

Contig8820_0_0_g16

Description

MIF4G domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL049C0.00000000009001903211590313TIF4632 SGDID:S000003017, Chr
VII from 409604-406860, G...
T. thermophilaTTHERM_012434700.00003998524687536623MIF4G domain containing protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8820.0.0.g16(coding)
ATGTAGTTAGGTGGAGTTCCTCTGGTTGGTGGATCAAACGCTATGGACGCTTTGAATGGC
TACATAAATCCATTTGCTTCAAAGTCAGCAGCTGGAAGCAGTGCTGCACTTTAGAAGAAA
AAACAAGCAAATCAGAATGATGAAAGTAAGAAGAAGATATACTCTATCGAATTTATGATG
TCAATAAGAAATCAGAATAAAGATAGACCAGCAAATATGGCATTACTAGATTTTCCACAT
AAAAAACGCAGAAACCTTAAAAAGGGAGACATGACTGATAGTGACAAGTTCAATTTCACA
GTCAGAGAACTTAGAATTATGCTTAACAAGCTTTCTATTGATAACTTTGACACTGTTTCA
AAGAAGATTTTAAACGATTATGCAATAACTCCATCACTGTTAAACGAGCTAATGAAAATT
ATCTTTATGAAGGCAACTACTGAGGTAGCTTACTTGGAGGTGTACGTGCGCCTCTGCATT
TAATTGTTCAAGAAGTACAATGACAAGGAGAACAAAGAAATGAACTTCAAGAAATTGTTG
CTTATGAAGTGTCAGAAGCAATTCTACAAGATGTATGAGAAGGAGGAATAACAGAGGAAG
AGTAGAAAGGCAAGCATGTAGTTGGATGAGTAAAACTCATCAAATGCAATAGAATCAGAT
TTCAATAAGCAAATGCTCTTTGTATTTGACGAAAGTGACTTAAGACACAGACAAAAACTT
CAACTTTTTGGAAACATGTAGCTAATTGTTGAACTATACTTGCACAATCAAATTCCAGAA
GGAATCATCATGACATGCATTGCTTCACTTATGGAGGATCTTTAGAACGATTAGAGTGTT
GAGATTTTATGTCAAATGCTCACTAAAATTGCCACACATGTTACGAAGAAAGCAAGACAG
GAAAAGGAAAATGAGAAGCATATGAATCAAATCAATGCATCAGCTGAGAAAAGAGCAGCT
GCCAAGAGAAAATCAATTAAAAACTGCGCAATTAATCTTGAATATGTAGAAGGAACCCTA
CAAAGACTGTTTTCTTATAGAAACAGCGACAGCATGTCATCTAGAATAAAGTTTAAGATT
CAAGATTTGATGGATATCTACAACGAGCCAAACTCATGGAGAGAAGTGATATATGAGGAG
AGATTGATGATTGATAGCGAAGGTTTCCAATACAAATATGTACCTAAGGATATGATTTTA
AGTGAAGAGGCAGTCAAGAAAAATATGGGCTCAGGAAAGAGAAGAAAGGGAACTGAAAAC
AGTCAAAATGACGGGTACATGTATGTTAAGAAGAATCAAGAAAAAACCCCTTCACACAGC
AAAACAGATGGTAGTGGCTCAAAGACTGAGGGTGGATTGAAGTATTAAAACAAAAATCAT
GGCAGCAACAGCAGTTTAAAGAAGAATACTCTAACATCACTCCTCAGAGATCTCAAACCA
GATGGAAGCAGTGAGAAAGGAAATAAAGTAGTCTACTCAGAATCAGAATCTGAGGAAGAT
GAAAATGTTACAAAAATGATTGGCAGAAAGGTTTCAATGAATGAAACAAATGTAATTGGA
ATGAATTTCGAAAAGTACAACAACCAAAAGCCAACACAAGAAGTCAGAAGAAAGATTGCT
AATTACTTCGCAGAGTATAAAGAGAACAACGACTACGACAAAGAAACTCAAATTTAAGGT
TTCGTTTTCGTTGGATATATCTTGAACAACGCTTTTTCACAGGATTTACCAGGATGGAAC
CAAATTTTCAAGCTTATTTTTGAAGATTTGCTACTTAAAGAGAAATTCTTTACCAAAGAG
CAACTTCTAGAAGGTATTCATGTATCAATGGCAAATTTCCATGACACCTTGATTGATTAC
CCTAATTCAAAAGATTACGCATTCTAAATGTTCGAAAGATTAGGCGAGTTAGAAGTTTTA
AACCCAGAAATGATTGAAAAATATAGAAAGCATGTTGAAAATTTAGTAGCTGAAGTTGAA
GACTATTGA


>Contig8820.0.0.g16(protein)
MQLGGVPLVGGSNAMDALNGYINPFASKSAAGSSAALQKKKQANQNDESKKKIYSIEFMM
SIRNQNKDRPANMALLDFPHKKRRNLKKGDMTDSDKFNFTVRELRIMLNKLSIDNFDTVS
KKILNDYAITPSLLNELMKIIFMKATTEVAYLEVYVRLCIQLFKKYNDKENKEMNFKKLL
LMKCQKQFYKMYEKEEQQRKSRKASMQLDEQNSSNAIESDFNKQMLFVFDESDLRHRQKL
QLFGNMQLIVELYLHNQIPEGIIMTCIASLMEDLQNDQSVEILCQMLTKIATHVTKKARQ
EKENEKHMNQINASAEKRAAAKRKSIKNCAINLEYVEGTLQRLFSYRNSDSMSSRIKFKI
QDLMDIYNEPNSWREVIYEERLMIDSEGFQYKYVPKDMILSEEAVKKNMGSGKRRKGTEN
SQNDGYMYVKKNQEKTPSHSKTDGSGSKTEGGLKYQNKNHGSNSSLKKNTLTSLLRDLKP
DGSSEKGNKVVYSESESEEDENVTKMIGRKVSMNETNVIGMNFEKYNNQKPTQEVRRKIA
NYFAEYKENNDYDKETQIQGFVFVGYILNNAFSQDLPGWNQIFKLIFEDLLLKEKFFTKE
QLLEGIHVSMANFHDTLIDYPNSKDYAFQMFERLGELEVLNPEMIEKYRKHVENLVAEVE
DY