Identifiers and Description

Gene Model Identifier

Contig18957.0.g12

Standard Name

EIF4Ec

Aliases

Contig18957_0_g12

Description

Eukaryotic initiation factor 4E

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL139C3.9983110956465888e-22CDC33 SGDID:S000005499, Chr XV
from 61024-60383, Genome...
T. thermophilaTTHERM_005834200.00000000000008999700526206354Eukaryotic initiation factor 4
E family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18957.0.g12(coding)
ATGGAAGCTCCAGGTAGTGCAAGCCAAATTCAAAGCAACAACTCATCCCCATCAAAAGTT
GTGTCTGACACTGAGCGCGCTTTATAGCAGAGAAGCGACACTAAAAATTAAACAGATATA
CAGCCAGCTCCATAACTCCATGAATTGCTCAGCGAATGGACATTCTGGTTTGTGTATACT
TTATCACACAGAGAAAAGAAGAAGTTAGGAAAGAAAGCAAGGTTTAATGAGTATCAATTG
CATGAAGTATTCTCCTTTGGTACTGTTGAGGACTTCTGGAAAATGTACAACAACACATAC
CAGATAAGCGAGATAATCCCAAACACTGACTACCTGTTGTTTAAGAAGGGCATTAGACCA
GAGTGGGAAGACCCATATAACAAGCAGGGAGGCAAGTGGGTTGTGACTCTACCCATCGAA
GAAGATATGGAAGAAGAATGCAATGATGCCTGGTAGGGTCTAGTTTTGCACATGATAGGA
GGGCTCTTTGAACACTAAGAGTTAATTAACGGAGCTATCTTCTCAATTAGAGAGAAGCAT
TACAGAATAAGTCTGTGGTGCAACGACAACAACAACATCCCCAAGGTCAAAAGAATCGGA
AACAAGTTCAAGGATGTGTGCCAGTTGCCAGAGAAATTCATATTCAGCTATTAACTTCAT
CAGAAGGCACTTATGCACGAACTTGATAATGAAGCATTTATCACTCTCAAGGATTGA


>Contig18957.0.g12(protein)
MEAPGSASQIQSNNSSPSKVVSDTERALQQRSDTKNQTDIQPAPQLHELLSEWTFWFVYT
LSHREKKKLGKKARFNEYQLHEVFSFGTVEDFWKMYNNTYQISEIIPNTDYLLFKKGIRP
EWEDPYNKQGGKWVVTLPIEEDMEEECNDAWQGLVLHMIGGLFEHQELINGAIFSIREKH
YRISLWCNDNNNIPKVKRIGNKFKDVCQLPEKFIFSYQLHQKALMHELDNEAFITLKD