Identifiers and Description

Gene Model Identifier

Contig22586.0.g100

Standard Name

EIF4Ea

Aliases

Contig22586_0_g100

Description

Eukaryotic initiation factor 4E

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01652 ) Eukaryotic initiation factor 4E

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005834204.000352986427571e-28Eukaryotic initiation factor 4
E family protein
SGDYOL139C1.0004572433669413e-23CDC33 SGDID:S000005499, Chr XV
from 61024-60383, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22586.0.g100(coding)
ATGTCTGCATAAGATCAAGCCTCTTCAAAATAATATATTGCCAAGAAGGGTTAACCAACT
TCCTCAACTTAACAAGTTAACCAATAAAATGCTGATTTTTCAAATTAAGATCCCGCCATT
ATATCAGTAGCAGCTCAGCAGAAGCAGTCACCTTAACATTTCCATGATAGTGCACTTATT
GATGATGCAATTATTAGTACTTCCAAACAAACTAACGCAGGAGGTAATGCATTACAAAAA
AATGAGAACTTGGTGATTAATGCTGATGGCAAATCTGAGTTAGAGCACTCCTTCACTTAT
TGGATTTATCAGAAAACTATGTAACAAACTGCACATTTGGATTGGGAGAGCTAGATCAAG
CCAATTGCCAAGTTCAATACTGCTGAAGATTTCTGGGAGATATATTAATTCCTCAAGAGA
CCAAGCTAGCTGTAAAACGGCACCACTGTTCATTTGTTCGTTGATGATATCAAGCCTATG
TGGGAAGATGAAGCAAATAAGCTTGGAGGAAGATGGGTTATTAGAATGAATAAAGGATTC
TCTAACAAGCTCTGGGAAGACTTAACACTGGCAATGATTGGAGAGCAGTTTGAGTTAGAA
AATGAGATTCATGGAATAGTCATAGTCATCAAGCCAAACGGTGACACAATCGCAGTGTGG
AACAAGAACTCAAGAGATCAAGCAGTAGTTGACCAAATCAAAGCAGATCTTATCAGAGTA
TTGAACTTGCCAGATGATGTGAAGATGGACTACGAGCAATTCAACCCAGAGACCCCTTAA
CAAAAGTAGCAACCACAAGGCAACTGGGGTTAAGGCTAAGGATAACGCAGAGAGGAGAGA
AAAGAGAGACCAAACAGAGGTGGTTACGGAGATTAAAACGTAGGTGGAGGAAGTAACCAA
CAATAGCAATAGTAATACTAGTAGCAACCTGGAAACTAATCTTAACAAAATTTGCAGCAG
CAAAGATACAAGGCAAAGGGAAACGCTGGAGGACAACCAGAAAACGTCGGCGGGGCTCAT
AGAGGACCTAGAAACGATTAGTAGTAGTAACAGTAGTACAAAAAGCCTTAATAACAATGA


>Contig22586.0.g100(protein)
MSAQDQASSKQYIAKKGQPTSSTQQVNQQNADFSNQDPAIISVAAQQKQSPQHFHDSALI
DDAIISTSKQTNAGGNALQKNENLVINADGKSELEHSFTYWIYQKTMQQTAHLDWESQIK
PIAKFNTAEDFWEIYQFLKRPSQLQNGTTVHLFVDDIKPMWEDEANKLGGRWVIRMNKGF
SNKLWEDLTLAMIGEQFELENEIHGIVIVIKPNGDTIAVWNKNSRDQAVVDQIKADLIRV
LNLPDDVKMDYEQFNPETPQQKQQPQGNWGQGQGQRREERKERPNRGGYGDQNVGGGSNQ
QQQQQYQQQPGNQSQQNLQQQRYKAKGNAGGQPENVGGAHRGPRNDQQQQQQYKKPQQQ