Identifiers and Description

Gene Model Identifier

Contig2735.0.g121

Standard Name

EIF4A2b

Aliases

Contig2735_0_g121

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002207509.997093137033517e-262DEAD/DEAH box helicase family
protein
SGDYDR021W2.0009778678102968e-172FAL1 SGDID:S000002428, Chr IV
from 486804-488003, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2735.0.g121(coding)
ATGGAAGCCAAGAGATAAGTAGTAGACACTAGTTCTGCAACCAAAGGAGGAAACCCACTT
GATAAGGATGTCGAGATGGTAATAGAGGCGTCAGAGCAATTAGAAGTTGTCAAGAGCTTT
GATGATATGGGGCTAAGAGAAGAACTCCTTAGAGGTATTTACGCATATGGATTCAACAAA
CCATCTGCAGTTCAACAGAGAGCTATTTTGCCTATTATGAAGGGAAGAGATGTCATTGTT
TAAAGTCAAAGTGGAACAGGAAAAACTTGTGTTTTTACCTCAGGTGCTCTATAATCAATC
GATCTCCAGCTAAGAGAGCCTTAAGTTCTAATTCTTTCACCAACTAGAGAGCTGGCTGAG
TAGACATAAAAGGTTGCTTTAGCTCTTGGAGATTACATGCAAGTCAAGGTTCATTGCTGT
ATTGGAGGCAGAAACGTAAATGAAGATGTTTTCAAGTTTGAACACGGTTGTCATGTTGTC
TCAGGAACACCAGGCAGAGTTTTCGATATGATCCAGAGAAGAACTTTTAAAACTACTTCA
ATCAAGATGCTTATACTCGATGAAGCTGATGAAATGCTAAACCAAGGATTCAAAGACTAA
GTATATGATATCTACAGATATTTACCATACGGCACACAGTGTGTAGTCATTTCAGCTACT
CTTCCTCAAGAAATCTTGGAAATGACTAATAAGTTTATGAATGATCCCATCAAAATTCTG
GTCAAAAGAGATGAAATCACACTTGAAGGTATCAAACAATTTTTCGTTGCTGTAGATAAG
GAGGAATATAAGTTCGAAACACTTTGCGATCTTTATGATACTTTGACAATTACATAAGCT
GTAATTTTCTGCAATAAAAAGAGCAAAGTTGAGTGGTTAGCTAAAGAAATGAGAAAAGCT
AACTTTACAGTTTCATATATGCATGGTTAAATGCCTCAGAAAGAAAGAGATGCAATTATG
GCAGAATTTAGAGCAGGTCAAAGCAGAGTATTGATAACAACAGATGTTTGGGGAAGAGGT
CTCGATGTACAGCAGGTCAGTTTGGTCATCAACTATGACTTGCCATTAAACAGAGAATTG
TATATCCATAGAATCGGTAGATCTGGAAGATATGAAAGAAAGGGAGTCGCCATTAATTTT
GTAACAAATGAGGACGTCAGAATTCTCAGAGATATTGAGCAATATTATTCAACTCAAATC
GAAGAAATGCCAATGAATATCACTGGATTCATGTGA


>Contig2735.0.g121(protein)
MEAKRQVVDTSSATKGGNPLDKDVEMVIEASEQLEVVKSFDDMGLREELLRGIYAYGFNK
PSAVQQRAILPIMKGRDVIVQSQSGTGKTCVFTSGALQSIDLQLREPQVLILSPTRELAE
QTQKVALALGDYMQVKVHCCIGGRNVNEDVFKFEHGCHVVSGTPGRVFDMIQRRTFKTTS
IKMLILDEADEMLNQGFKDQVYDIYRYLPYGTQCVVISATLPQEILEMTNKFMNDPIKIL
VKRDEITLEGIKQFFVAVDKEEYKFETLCDLYDTLTITQAVIFCNKKSKVEWLAKEMRKA
NFTVSYMHGQMPQKERDAIMAEFRAGQSRVLITTDVWGRGLDVQQVSLVINYDLPLNREL
YIHRIGRSGRYERKGVAINFVTNEDVRILRDIEQYYSTQIEEMPMNITGFM