Identifiers and Description

Gene Model Identifier

Contig2122.0.g98

Standard Name

EIF4A2a

Aliases

Contig2122_0_g98

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKR059W2.9999444238666675e-148TIF1 SGDID:S000001767, Chr XI
from 554987-556174, Genom...
T. thermophilaTTHERM_002207501.000008670162283e-147DEAD/DEAH box helicase family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2122.0.g98(coding)
ATGGACAGACAAAACATGAACTAAGTTGAAGAGGAGAAGAGAAACGACTCAGAAGCTATT
ACTAAGGAAGACGAAGAAGAATTCATCACCAACTGGGATGAGGTAGTCGAAAGCTTCGAT
GACATGGGACTTAAAGAAGGAGTACTGAGAGGAATCTACGGTCATGGTTTCGTTAAGCCT
TCTCCAATTCAACAAAAGGGAATCCTACCCGTCATTCAGGGCAAGGATACTATCGCTCAA
GCTCAATCAGGTACAGGCAAAACTGGTTGCTTCACCATTTCAATTCTACAGATTATTGAT
ACTGCCTCAGTCAACACTCAAGCTTTGATTGTTGCACCCACCAGAGAGCTCGCTCAACAG
ATCGCTTACGTCGTGTAAGCCATCGGTGAGTTCATTGGTGTTAAAGTTCACGCTTGCGTC
GGAGGTACCGTTGTTAGAGATGAAATCAGAATTCTCAAGCAAGGTGTCCACGTCGTAGTC
GGAACCCCAGGAAGAGTCTTAGATATGATGAAAAAGGGCTTCTTGAAAGCTGACCATCTC
AGAGTCTTCTGCTTGGATGAAGCTGACGAAATGCTTTCAAGAGGTTTCAAGACCCAAATT
CAAGACATCTTCAAGTACCTCCCAGCTGAGATTCAAATCGCTTTGTTCTCAGCCACCATG
CCAATGGACATTCTCAAGCTTACCAAGCATTTCATGAGAGACCCAGCAAAGATCTTGGTT
AAAAACGAGGACTTGACCCTCGAAGGTATCAAGCAGTACTATATCCCAATCGAGAGAGAG
GAGTGGAAGATCGACATCTTGCTCGATCTCTATGGAAATCTCGATATCAACCAGGCCTTG
ATTTATTGCAACACCAAGAAGAGAGTTATGGAACTCGCTGAACTCATGAAGGAGAAAGAT
TTCGTCGTGTCAGCTATGCACGGAGAGATGGATCAAATCACCAGAGACATGATCATGAAG
GAATTCAGAACTGGTTCAACCAGAGTTCTCATTACCACCGATTTGATGGCAAGAGGTATC
GATGTACAACAAGTCTCATTGGTCATCAACTACGAGCTCCCATTGAAGAAGGAAAACTAC
ATTCACAGAATTGGAAGAGCCGGAAGATATGGAAGAAAGGGAACTGCTATCAACTTCGTC
TCCCCCAATGACGCCAGATTCATCAAGGAAATCCAAGAGCATTACATGACTCAAATTGAA
GAAATGCCACAAGATTTGAACGAATTGAACGATTGA


>Contig2122.0.g98(protein)
MDRQNMNQVEEEKRNDSEAITKEDEEEFITNWDEVVESFDDMGLKEGVLRGIYGHGFVKP
SPIQQKGILPVIQGKDTIAQAQSGTGKTGCFTISILQIIDTASVNTQALIVAPTRELAQQ
IAYVVQAIGEFIGVKVHACVGGTVVRDEIRILKQGVHVVVGTPGRVLDMMKKGFLKADHL
RVFCLDEADEMLSRGFKTQIQDIFKYLPAEIQIALFSATMPMDILKLTKHFMRDPAKILV
KNEDLTLEGIKQYYIPIEREEWKIDILLDLYGNLDINQALIYCNTKKRVMELAELMKEKD
FVVSAMHGEMDQITRDMIMKEFRTGSTRVLITTDLMARGIDVQQVSLVINYELPLKKENY
IHRIGRAGRYGRKGTAINFVSPNDARFIKEIQEHYMTQIEEMPQDLNELND