Identifiers and Description

Gene Model Identifier

Contig20188.0.g97

Standard Name

EIF3H

Aliases

Contig20188_0_g97

Description

JAB1/Mov34/MPN/PAD-1 ubiquitin protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01398 ) JAB1/Mov34/MPN/PAD-1 ubiquitin protease
  • ( pfam04876 ) Tenuivirus major non-capsid protein
  • ( pfam02895 ) Signal transducing histidine kinase, homodimeric domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006539400.000000004999139696582238Mov34/MPN/PAD-1 family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20188.0.g97(coding)
ATGATCGACACCACAGCTCTTTTGAACATGGTGAAGCATTGCAGAGAAGCCGACTGGAGA
GCAGGTGGTCTAGGTATGCTCATGGGAGTGCTCAAGGACGATGACACTCTTATGATTACT
CAAACTATGCCAGAGGTAAATAAATCACAGATGGATGAGCTCACTGCCGCCATGGAATAA
GAAAGCCAAAAATTGATGGACACCACTAAAGTAGGTTTCTATCTCAGTGCACATATGGGT
CTCACTTTTAACATCGAAACTCTTAAGAATTTGTACAAGTGCTACAAGCAATTCAAGAAT
TCAGTATTCCTTATCTACGATATCTCCAAGGCAAACTTTGGCATGAATCCCCTTCATTGT
TATAGACTGTCAGAAAAGGCTATTGACACTCTAGAGAAGAATGCAAACGCTGCCATCGAT
AAAATGAACTTGGTCCAAGATAAAATCAGATCTCAAAACTTAACCATTGAAGAAATGTTC
GAGGAAGTACCAATCAGAATTTACAGAAGTCATTTATTGCAAGCATTCTTATTCGATCAT
ATTCAACCACACATGCCAGCTTTCAACACTAACCTGTTTAAATTGGCAACACCCCAATAC
CTCTGCAACCACGTCTATCAATTGAATGAAGCCACTGAAGAATTGGTATTCGAGCAATAG
AGACTAGAGCAATAACAAAGACAAATGATGAAGGCTCAAAAGAGACTACAATCCAAATAG
AAGTATGATGGAGTTCCATAAACTGTCCTTGAAGATATCACTAATAATAAACTTGACTTG
TTCTTACTTAGCAGGTAGGTTGATGAACTATGCAGTCAAATCAGCGATTGTGGTATCACA
GATAACGGTATGAGCGCAAGAATTGCTTTACAATGA


>Contig20188.0.g97(protein)
MIDTTALLNMVKHCREADWRAGGLGMLMGVLKDDDTLMITQTMPEVNKSQMDELTAAMEQ
ESQKLMDTTKVGFYLSAHMGLTFNIETLKNLYKCYKQFKNSVFLIYDISKANFGMNPLHC
YRLSEKAIDTLEKNANAAIDKMNLVQDKIRSQNLTIEEMFEEVPIRIYRSHLLQAFLFDH
IQPHMPAFNTNLFKLATPQYLCNHVYQLNEATEELVFEQQRLEQQQRQMMKAQKRLQSKQ
KYDGVPQTVLEDITNNKLDLFLLSRQVDELCSQISDCGITDNGMSARIALQ