Identifiers and Description

Gene Model Identifier

Contig16491.0.g120

Standard Name

EIF3D

Aliases

Contig16491_0_g120

Description

Eukaryotic translation initiation factor 3 subunit 7 (eIF-3)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam05091 ) Eukaryotic translation initiation factor 3 subunit 7 (eIF-3)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002840303.9989916100764785e-24hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16491.0.g120(coding)
ATGGTAGACAAACTTGATTTAAGTGATTTAGGAGTCTCTCTTAACAACAGTGTATTTGGC
CCTTCAGCAGGCACTCAATGGGATAATTTCGATGGTAAATTCTATCAACCCTACAATAAA
AAGGAGAAAATCGGTAAAGTATGCGACTTTGTATCAGTAGCAACTCAGCAAGCAATGGCT
CAAGCAAACCTCTCAACTGCTGCTCACACCAAGTTAACTCAGAAAACTCAAGCCGCAGCT
GCCGCTCAAGCAGCTCCATAGAAGGAATTGTTCGATGAGGATGATAAGGGATTTGAAGTA
GTTGAACAAGAGACTGTGGTAAAGAAGAAGAAGACCTATACTCAAGGTGAACGTGGAGGC
AGAGGTGGCTATCAACAAAGAGGTGGCTACTAAAACTGGCATTAAAGAGGAGCTCAAAGA
GGCGGAAGAGGTGGGAACCAAAGAGGTGGCAGAGGTGGCTACTACAGAGGACAACAAGAC
TACGGTGGATTTGTACACAATTTTGGTAAGAGAGGTTTCAGAGAAGCATCTATCGAAATT
AGAGGTGACTGGCCAGTTATTGAAGAGCTTAGCAAGAATCAACTTGAGAAACTTAACCCA
GTACAAGCTACTCTCTCATCTGTAGCCGCTTAGTGTGGTGAAATTCATGCATACAATCGT
GATCTTGACAAGGCAAGAACCTACAAGCCTCAATCCCTCTAAGTATTCAACGGTCAGGTG
TTCAACGTGCAGACTCTCGACGACCCAGTAATCAAGAGACTTGCTCAAGAGAACAAAGCT
CAAATCTTCGCAACAGAAACTGCAGTAGCTGCCATCATGACCGCACCTAAGAGTTTGTAC
TCTTGGGATGTCGTGATCAAGAAGTATTTAGACAAGATCTTCATCGATAAGAGAGATGAG
CATAACATGCTCGACAACTTGACAGTTAATGAGACCTCCTCAGAAAATCAACCAATGGAC
GATGAGACCCTCAATGGAGTGAGGCAATTGATGGCTGAGGCCGTGAATGTTAACAATTCC
TGGAGATATCAACAGTATGCTAAAAACTAGAAAATTGACTTGGCTGAGAAAGATCCATTC
GTGGAAGTTGAAGGATAGGTTGCAGCAAGACTTGGATATTTGTATAAGATATGGGATCTT
GGTAATAAGAGAAAGATTTGCATTAGATCAACCGTACACGCCTATCTACCTAAACAAGAA
TAGGAGCCAGTTGACGAAGAATCAAAGGAAGAAGCCAAGCAAGTGAAACAAATCTATCAA
AACACCTACGCTGTAGTCGAGTACGAGAACAATAAGAGCAACTGGAAACAAAACCTCGAT
TTAATGATGGGTCAGTGCATGACTAGAGAAGTCCAAGACAACAGTGCCAAGGTCACTAGA
TGGGTCATTGAGTCCCTATTGGCAGGTGCTGAACAAATCAAATTCGCTTTCTTAACTCGT
AAGACAGCCAAGTCCAACCAAGGCCACATTTTATTAGGCACCTATGGCGTGAGCACTAAT
TCCTTCGCAAACCAGATTAACTTGAACATGTCCAACTGCTGGGCTATCCTTAGAGATCTT
ATTGATGGAATCTATATTGACGGTAAAAAGACTGGTGAGCAGTCTGGAGAGTACATTTAC
ATGAAGGATCCAAACAAGGCACTAATGAGATTGTTCAGAATCACAGCCGAGGACGAAGAT
GAAGAGGATCAGGATGACGAATTATGA


>Contig16491.0.g120(protein)
MVDKLDLSDLGVSLNNSVFGPSAGTQWDNFDGKFYQPYNKKEKIGKVCDFVSVATQQAMA
QANLSTAAHTKLTQKTQAAAAAQAAPQKELFDEDDKGFEVVEQETVVKKKKTYTQGERGG
RGGYQQRGGYQNWHQRGAQRGGRGGNQRGGRGGYYRGQQDYGGFVHNFGKRGFREASIEI
RGDWPVIEELSKNQLEKLNPVQATLSSVAAQCGEIHAYNRDLDKARTYKPQSLQVFNGQV
FNVQTLDDPVIKRLAQENKAQIFATETAVAAIMTAPKSLYSWDVVIKKYLDKIFIDKRDE
HNMLDNLTVNETSSENQPMDDETLNGVRQLMAEAVNVNNSWRYQQYAKNQKIDLAEKDPF
VEVEGQVAARLGYLYKIWDLGNKRKICIRSTVHAYLPKQEQEPVDEESKEEAKQVKQIYQ
NTYAVVEYENNKSNWKQNLDLMMGQCMTREVQDNSAKVTRWVIESLLAGAEQIKFAFLTR
KTAKSNQGHILLGTYGVSTNSFANQINLNMSNCWAILRDLIDGIYIDGKKTGEQSGEYIY
MKDPNKALMRLFRITAEDEDEEDQDDEL