Identifiers and Description

Gene Model Identifier

Contig12701.0.0.g15

Standard Name

EIF3C

Aliases

Contig12701_0_0_g15

Description

Eukaryotic translation initiation factor 3 subunit 8 N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • eukaryotic translation initiation factor 3 complex (IEA) | GO:0005852

Molecular Function

Biological Process

Domains

  • ( pfam05470 ) Eukaryotic translation initiation factor 3 subunit 8 N-terminus
  • ( pfam01399 ) PCI domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYMR309C6.001502944943701e-53NIP1 SGDID:S000004926, Chr XII
I from 895426-892988, Gen...
T. thermophilaTTHERM_003785601.000159011384939e-43eukaryotic translation initiat
ion factor 3 su...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12701.0.0.g15(coding)
ATGAACAAGTGGTTCGCAAGCGCAAGAGATCTCTCCGACTCAGAGTCAAGTGGTGACTCA
TCAGACGACGAAAAGAAGCCAACTCAGACTCAACAGACTGCAGTTGCCAGTAAAAAGGCA
GTTATTGCTCAAAAGAAAAATTACATGAAAAACTTCGAGGACTCATCAGAGAGCGAAGAG
GAAAACAGAACTATAGTGTCTAAGAGTGATAAGCAACTCGAGAATATCAATGCAATCAGC
AAAGATATTAAAAACCATCTTAAGAACAACGATTTCTCAGCTTTAATGCAAGACTTCGAG
AAATTCGCAGAGGAACTAGATAAAGATTCAAACCAGAACCGTGGCATAATCTACCAACAC
GGCAAGGATGGAATTTTACCTATCTAATATCTAAGGTTACTTGTGAAAATCGAGGATGCC
ATAAACGAGACAAACGCCTTATTAAAGGAAAAGAAGATGAATTTGAACAAGACTAACAGT
GTTTCTCTCAACAAGCTCAAACAAAAGATGAAGAAGTACGTTCAAGTTGCTGGACCAGCT
GACAATACTCTTGAAAACTAAATCACCAAGTTCAGAGACGCTCCAGTGTGGAGTGATGAT
GAGAAGAAAGCTGCTAAAGCTCAGACTAAGAAGACTGAAGACAAGAAGGCTGCCAAAAAG
GAAGATGCTAAGAAAGTTGTTGCCAAAAAGCCCAAGGATTCAGACAGTGAATCTGAAAAC
AGTGATGAGGAAGACAAGGCTGCAGGCGAGGAAGATGAGGAGTCTTACTACGACGAAGAA
GAAGGATCAGAGGAGTCTGAGTCCAGTGAAGAGGAAGAAGTCGATATCTTCAAGATTCCA
AGAGAGCAAATGACACCTGCCCAAAGAAGACTTAAGTGGGTTAAGAAGGACAGACTTCCA
CAATATCTTCAAGATATTCTCAACAAAAAGAAGACAACTAAAGTTGTTGAAAAAGAGAAA
GATAAAAAGGCTGGAGAAGATAAGGTCGAGCAAATCACCAAGGCTATCTAAGGCACCGAG
AAAGAGGCTAAAGAAACTGTCTTGGACATTAAATCTAACTATCAGACAATTGATTTCACA
AAAACTGACAATGTTGTTAAGAAGCTCAAAGAACTATAAGATGAAAGAATGAGAGGTAAA
TTTGATCCAAAGTACCACTTATAAGTTCTTACTTTCATTTTGCAACAAGTTAAGGATGCT
AGACAAAAGGTTGAGATAACTCTTAACCTATTGAACTCTATGTTTGATTCAGCCAAAACC
TCAGCTCTTGGTTATATGGGCAGAGAATTATGGTTAATCACATACGAGCACCTCAATTCT
TTAATATAATTGCTCGAGACTCCTCAAATGAAAGAATCATTAAAGACTTATCTCTAAAAG
GAGCAAAGACTTCTCTAAGCAAAAGAAGCTGCTGAAGATGCAGAAGAAAGCGAAGAAGAA
AATATAAACCAGATTTCTGCTACTGCTGAAATTGAAAAGTCAATCCTCCCATCTCTCGCA
AACTTCATTGAAAAGCTAGATCATGAAATGCTAAAAGCATTTTAAAGTACACCTCACACA
AAAATTGATTATCTCCTAAGACTTAGAGATGAGAACAAGTTTTTGTCTATTCTAGATAAG
GTATTTGACTTCTTAATGGCCAACGAAGATAAGAGCAAGGCATCAAGAGTTGCTGTTATT
AAACTTGATCATCTTTATTATAAGAATGACTCAATCTATAAGAAGTACAGTGAATAAGTT
AACGGTAACGCTGACAACACACCATACACTTTGAACGGTGAGAGCACAAAGGTTTTAAGA
GAATTGGTAGATTTAGTTACAGCTCATGGAACCGCTAGAATGAAGATTAGAGCTGCTTTG
TACATTGTTTACCATCACAGTATTCACAATAGATTCAAGGAGGCAAAGGACTTTTTACTC
AGAACTCATATTGCTGACATTATAAGTTTACAAGATATTGGAACTCAAATAATTTACAAT
AGAGCTATTACTTAAATTGGTATGTCAGCTTTCAGACTTGGCTTGATCGAAGATGCTCAT
GATGTATTGGTTGATATTTGCTAAACTGCAAAGCTAAGAGAAGTCCTTGCTCAAGGTATC
TCAAGAACTCCAGACAAGACTATTGAAATTGAAAGAGAAGAATTAAAGAGACAAATTCCA
TTCCACATGCACATCAACCTTCATCAACTTGACTGCATCTACATGATCAGTGCTATGCTA
CTTGAAATTCCAAATGTTGCTGAAAATCAATTCTCAGTCAACAAGAAAATCATCAGCAAA
AACTTCAAGAAGCTTATTGATCAATATGACCAAAAGGCTTTCGTCCTAGCTGCTGAAAAC
TACAGAGATAACTTAGTCTTTGCCGCTAAGGAGCTCAATAGAAGTAACTGGAAAGCTGCA
ATCAATCACATTTTCTCAATCAAATTGGTAGTTAAGATGCCAGAGTTTTCAAGCGATTAG
AGTCCCCACAGATAACAACTTATCCAAAGATTCAAGGAAGCCTCACTTAAGGCTTTTCTC
TGCAGAAGCTCAAAGAACTACAACTCCTTCGGCTTATAGTCTCTTATTGAGCAGTTTGAA
CTACCTGAATCAAAATTAATGCAAATCGTAAGCAAAATGATTGTGAGAAACAAGATCCAA
GCTCACTTCGACAAGAACAGAGAGCTCTTAATCATTGATAATAAATCCAACGATATGAAG
GAGCTCCAACAACTCAGCTTGCAATACGTTGACAAATTAGAGTTAATGGTAGAGAACAAT
GAGAGAATAATCGATATGATCGGAGATGGCAAGATCTACAACTATAAGGAGAGGACTGCA
AATGAAATATTCGCCATCAATGCTAACAAGAGGTAGAAGCAAATTATGAAGCAAACTGGA
GGTCTGCCAAGCGTGGGTCAATAGACATAAAATATGATTATATAGAATCCAGTTCAAAGG
AGATGA


>Contig12701.0.0.g15(protein)
MNKWFASARDLSDSESSGDSSDDEKKPTQTQQTAVASKKAVIAQKKNYMKNFEDSSESEE
ENRTIVSKSDKQLENINAISKDIKNHLKNNDFSALMQDFEKFAEELDKDSNQNRGIIYQH
GKDGILPIQYLRLLVKIEDAINETNALLKEKKMNLNKTNSVSLNKLKQKMKKYVQVAGPA
DNTLENQITKFRDAPVWSDDEKKAAKAQTKKTEDKKAAKKEDAKKVVAKKPKDSDSESEN
SDEEDKAAGEEDEESYYDEEEGSEESESSEEEEVDIFKIPREQMTPAQRRLKWVKKDRLP
QYLQDILNKKKTTKVVEKEKDKKAGEDKVEQITKAIQGTEKEAKETVLDIKSNYQTIDFT
KTDNVVKKLKELQDERMRGKFDPKYHLQVLTFILQQVKDARQKVEITLNLLNSMFDSAKT
SALGYMGRELWLITYEHLNSLIQLLETPQMKESLKTYLQKEQRLLQAKEAAEDAEESEEE
NINQISATAEIEKSILPSLANFIEKLDHEMLKAFQSTPHTKIDYLLRLRDENKFLSILDK
VFDFLMANEDKSKASRVAVIKLDHLYYKNDSIYKKYSEQVNGNADNTPYTLNGESTKVLR
ELVDLVTAHGTARMKIRAALYIVYHHSIHNRFKEAKDFLLRTHIADIISLQDIGTQIIYN
RAITQIGMSAFRLGLIEDAHDVLVDICQTAKLREVLAQGISRTPDKTIEIEREELKRQIP
FHMHINLHQLDCIYMISAMLLEIPNVAENQFSVNKKIISKNFKKLIDQYDQKAFVLAAEN
YRDNLVFAAKELNRSNWKAAINHIFSIKLVVKMPEFSSDQSPHRQQLIQRFKEASLKAFL
CRSSKNYNSFGLQSLIEQFELPESKLMQIVSKMIVRNKIQAHFDKNRELLIIDNKSNDMK
ELQQLSLQYVDKLELMVENNERIIDMIGDGKIYNYKERTANEIFAINANKRQKQIMKQTG
GLPSVGQQTQNMIIQNPVQRR