Identifiers and Description

Gene Model Identifier

Contig19782.0.g58

Standard Name

EIF3B

Aliases

Contig19782_0_g58

Description

Eukaryotic translation initiation factor eIF2A

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08662 ) Eukaryotic translation initiation factor eIF2A
  • ( pfam05979 ) Bacterial protein of unknown function (DUF896)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004431002.0006622580855403e-35hypothetical protein
SGDYOR361C2.99851380290819e-19PRT1 SGDID:S000005888, Chr XV
from 1017652-1015361, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19782.0.g58(coding)
ATGAGTCTATCTCTTGACGAAGCTCTAAACAGAGTCCACGGCAGCGATGCCTTTAGAAAA
ATCTAGAACCTCTATCCAAATTTCAGCTTTGAGGAGGAAATCAAGCAAAACATTGAAGTT
AGTGAGTATATCAGAAATGCTTGCTTGTCTAATGTTGCCATGATCGAAGATCCAAAGACC
AAGTCAGACGCACCCAAGCTTAACGAAGATTTCTCAAAGTACTTTGTCATCAATAATTTG
CCAATTTGCGACGCTGAGAAATCCAAGAAGCTTATCCAGCTTATCATTAAATTGTACCAA
AAGAAAGAAATCTCTTTCACTGAGAATGATATTACTATGCCACTTGATGCTAATGGCAAT
ACTTAAGGAGTAGCGTTTTTCGTAGCTGCTTCCGAAGAAAAAGCAAAATTAGCTGCTGCT
ATTATGAACGACTATCAATTCGATAAGAAGCATTTGCTCTCTGCAAGTCAGATCAATGAC
TTCGAAAAAATTATGCAAACAAGAGATCTCTAAGAAGGGCCAAGAACCTCCTCTCTTATT
GATCTGAGAGACCCTATACTAGATACCAAGAGGGAGCAATACTTATTCCAAACTGGTAAA
GAAGTAAACTTGAAATGGCATGATGGTACAGTTGGAGCTACTGATTCAAATGTTGCTGCA
GCAAATCTCCAAAGTGACAGACCAGTCCAATGGAGCCCTAAGGGTACTTACTTGATCGTC
ATAAAGCACGATAAAGTTGAGTTCCATGGAGGCAAACACATGCAACCAATCATTACTATT
CCAGAGCCTAAGGTTGAGAACGTTAACATGTCACCTTGCGAAAGATACGTACTCACTTAT
GCTCCAACTTAAAAGAGCCCATATGTTGTTTGGGATTTCTAGCTTGTTGAATAAATCAGA
GATTTTGATCAAAAGAGAGGTGAAAGCTTTACTACCTATCAATGGTCATTTGATGGTAAC
TATCTAGCTAAGAAGTTTGAGCAAGAAATTAAAAAAGAAGGCTAAGAAGAAGCTGAAAAG
ACTAAGAAAGGTCTTTCAGTTTACAAACTTCCCACTATGGAATTAATTGAAAATGCAGAA
GGCCTCAAGAAGTCAATTACTATTGAAGGCATTGAAGACTGGCAGTGGGCACCTCACAGA
AACTTCATTGTTTACTCTGCTTTCCCACCTGAAGAAAACTAGTTCCCAAGAATCGGTTTC
CTTGAAATTCCATCAAGAAAGCCAACAATTAAGACTTTTGCTGCTGCAAGAGCATTCAAG
CTATATTTCCATCCTCAAGGTGACTACTTGGCTATTATGAATGAATATCAACAAAAGAAG
ACTATTAAGTACTCAGTTGAGTTGTTCGATACAAAGAAAAATTCCTTCCCTCACCAATAA
ATCCTTGTTAACAGAGATGTTATCGAATTCAACGGAGTTATCTGGGAGCCATTCCACTCA
AAGATGGCAATTCATACACTTTCAAAGCGTGTTGTTGAAGCAGGTAAGAAAGACTACACT
CTTGATGCCAAAAGAAACGGAGTTGACATTTATGAAATGATTGACGACCAAATCAAGGGA
TTCGTCACTAAGACTATTGGTTACTTACCTAGTGAAAAAGTTGTCAAGTTCAGCTTTTCT
GGTTCTGGAGATATTTTTACAGTTTATGAACAAGAAGCTAGAATGGCTACAGTTTCATTT
TACATGATCATGAAACAACAACCAGATACTGCTAATGCTGTAGGTGGACCAGTAAAGAAG
TCCGGTCCTTCATAAGTAAACAAACTTTCAAGTGCTGAAGAGAAATTCGAGTTCAAGAAA
ACCGCAAAGTAAGACATCTATGAAACCAAGTTTGAGGAGGTCTGGGATTAAACTGGCAGA
TACCTCGCTATCTATGGAATCAAGCGTTCTCCTTTAGACAAAACTGAGAAATCAGTTAAA
TTCTATAATATCTTTGGAGATCTTTTAAGCCAACATGAAGGTCTATAAAATCTCTAACAA
TTCAAATGGAGGCCCAGACCTACTGGCACACTTAAGCCAAAGGAAGTACAAAAGATCAAA
TCTGAATACAAGACTAAGTATCTTAAGAAATTCAAGGAAGAGGAGAAATCTTAAAAGAAA
GCCACTACCAGTGTTGAAAAAGAACAAAGAAAGTAAATTAGAGACGAATTCCTAAATAAC
TTCTTCTTGCCCTTAAGAAAAGAGTTCGAAGATAATATTTCAGAGTACGAGAAACTTTGG
CCAATCAAGGATAAAGATATGGCTGCAACTGAGGTAGAACTTGAAATTATCTATGCATAC
GATAATGTCATTTCAGAAAGAAAGATCAACTGA


>Contig19782.0.g58(protein)
MSLSLDEALNRVHGSDAFRKIQNLYPNFSFEEEIKQNIEVSEYIRNACLSNVAMIEDPKT
KSDAPKLNEDFSKYFVINNLPICDAEKSKKLIQLIIKLYQKKEISFTENDITMPLDANGN
TQGVAFFVAASEEKAKLAAAIMNDYQFDKKHLLSASQINDFEKIMQTRDLQEGPRTSSLI
DLRDPILDTKREQYLFQTGKEVNLKWHDGTVGATDSNVAAANLQSDRPVQWSPKGTYLIV
IKHDKVEFHGGKHMQPIITIPEPKVENVNMSPCERYVLTYAPTQKSPYVVWDFQLVEQIR
DFDQKRGESFTTYQWSFDGNYLAKKFEQEIKKEGQEEAEKTKKGLSVYKLPTMELIENAE
GLKKSITIEGIEDWQWAPHRNFIVYSAFPPEENQFPRIGFLEIPSRKPTIKTFAAARAFK
LYFHPQGDYLAIMNEYQQKKTIKYSVELFDTKKNSFPHQQILVNRDVIEFNGVIWEPFHS
KMAIHTLSKRVVEAGKKDYTLDAKRNGVDIYEMIDDQIKGFVTKTIGYLPSEKVVKFSFS
GSGDIFTVYEQEARMATVSFYMIMKQQPDTANAVGGPVKKSGPSQVNKLSSAEEKFEFKK
TAKQDIYETKFEEVWDQTGRYLAIYGIKRSPLDKTEKSVKFYNIFGDLLSQHEGLQNLQQ
FKWRPRPTGTLKPKEVQKIKSEYKTKYLKKFKEEEKSQKKATTSVEKEQRKQIRDEFLNN
FFLPLRKEFEDNISEYEKLWPIKDKDMAATEVELEIIYAYDNVISERKIN