Identifiers and Description

Gene Model Identifier

Contig721.1.g109

Standard Name

EIF3A

Aliases

Contig721_1_g109

Description

Rdx family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008130404.00073564232477e-35hypothetical protein
SGDYBR079C9.997975313387782e-28RPG1 SGDID:S000000283, Chr II
from 398277-395383, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig721.1.g109(coding)
ATGAGTTATATCAATCCAGAGAACGCTTTAAAGCACGCTCAGGAATTCAAGGCAGAGGGA
AACATTGAAGGAGCTCTTGAAGAACTTCATCAAGCCCTACATGGCAAAAAGTTCAAGGGA
AACAACATTATCTTAGAGAGAATCATGCTTGAAATGATTGACATTTGCTCTGATTAACTT
TCTACTGCTTACCTTAAGGAAGACATTGGTCACTTCAGAAATGTGTGCCAACACACTAAC
ATGAGCTTGTTGGAAAACGTTCTCAAGACTCTTAAGGCAAGAACCGATCAAATCCTCATT
AAAATCGAGGAATAAGAGGGTGAAGAGAAACTCAGACAAGTACTAAGCGACGACTCAGCT
CAAAATCTCTCATTGAACACTGGAGATGGAGACATCAACCCAGAAGACCTCATCGTGATG
GCTAACTGTCAATTCCATTAAATCGAGGCCAAAAACAAGATTATGCCATCTGTTAACTTC
TTCATTGATGTCTGCAAAATCATCTTAGATACTCTCCGTCAAAACTCCAAGATGCTTGAT
TTCTACAATCAAACCGCCTAAAAATGCTTCGAGTTCTGTGCTAAGTACAACTACAAATCA
GAGTACCAGAAGATCTCTGAGACTCTTCACAGTCATTTCAACCAGATTTTGAAGCAAGCC
AAGCACCCCGAAACCCTCATTCAATCTAAAATCCCCTTCCCAGTCAAGCTTGACGAGGAT
GACGCCCTTTAAAAAGTGCTTGAGCTTAGATACTAACAATTGAAAATAGCTCTCAAGATG
AAAGTTTGGTCAGACGCTTTCAGAACATCAGAGAACATTTATTAGCTAATCAACCGTAAC
AAACATCAACATCACGCTTCTAGAATGAAGCAAATTCTTGCTGATTTCTTCCAAAACTTG
GCTTTAATCTTTTGGGAATCAGATTTCTACTTGTTCCACGCCTATTCTTTAATGAATCTC
TAATCAATTAATAAGGCTTCAAAGACCATGTCAGAGCAATAAAAGTCCTCAATGGCTGCC
CAGTTTGTTTTGGCTACTCTCTCAATCCCTCTTGATAACAAGCTTTCAAACTTCGAAAGA
CTCAACGTCCAATACATCCCATAGGGTATGAATGAGTTCTTCGATGAATCAAGTCAAATT
AGAAATGAACTATTTGGAATTGCCAGCATGCTTCAAGTCAAGGGTATTCCATCAAGAGCT
AGTTTGATTAACTACTTGAAAATCAAGAACTTGCATTTGAACTAAGAGTTCCCACAAATT
CAAGAACTTTTCAGACTTATTGAGGAAGAAGAGTCACCATTCAACATTTCAAAGAGAGGT
AAAATTATTATTGATGAGCTCATGGCTATTCCAAACACCAACTGGAGTTAATACAAAGAC
TTTATCATCAAGACTCTCTCTGTGAGAATCCTCTAGAAATGCAAAAACTACTTCAAAAAT
TTGAAGATTTAAAGTCTCTCAAAGTTACTTATTTTCTTCAACTCATTCACTGAGATTGAA
TCACTTCTTTACGAGTGCAATAGATAAAACTTAATCCAAACTGTCATTGATTATCAAACC
CAATCTATCACTTTCAACCAAGAAGTCGAAGTTGCAAACAATCTTTTGAAATTCGGTCAC
AAACTCAAGGAAGCATTCCAAAGAGTTCAAGATGTCATGTCTGAGGGCAAGGAGCGTGAG
AGAATCTTCATGAAGGTCAAGGAAAAGATGGAGCAAGAAATGAACGATGTGCTTAAACGT
AAAGTCGACATGGTAAAGATGAAGGAAAACATTGCCAGAACTCAAGCCGAAGAGCACAAA
TCTCTCCAAGATTTATTCCAACAATAACAATCAGAGAAGGAAAAGGAATTCAACTAGCAA
AGAGTCAAGGAAGAAAAAGAGAGATAGAAGAACAAGCTCTTGGAAGAACTCGAAGTCATG
AGAAAAATTAGAGCTCAAGAAGTCGTTTAAGAGTTACTCAGAAAGAACATTAAGAAAATT
AACGGTATCAAGATTGATAAGCAAGGATAAGATCAAGAATTAGATTATGACACAATCATG
AACTTTTACCAGAACCTCCTCAGAAAAGAAAAGGAGCAATTCGAGGTTGTCAAGAAGCAA
AAGCTCAAGGACACTGATCACTGGGCCAGAGCACTCCGTGAGGAAGAGAAAGTAGTGATT
GAGAAGTACTGTGCTGAACATGGCGAGGAAGAAATGAAGCAGATCCAGAAAGCCATCGCT
GACAGAAACGAGAAGGAACTCAAAATGAGATTGGCCTTGGAGAGAGCATACCCAGTTTAC
CAGAGATTCAGAGAAGATGTGATGACAGTCAGAAAAGTTGAGTTCTAGAATAAAATGAAG
GAATTCATTGACAAGAAGGGAAATGAACTCAAGGAAGACCTTCTTTCACAAGCCTTGAGA
GAACTCAAGAAGATTGAGAACATCAGAAAGGTACAAGATGCTGAGAAAGCTAGAAAGGAA
AGAGATGCTAAGATTTCTGCTGAAAAGAAAGCTAAGGGTATCACTGAAGAGACACTTGAA
GAAGATGGAACTTTAGGTATTGGCTGGGGCAGAGGAGTCAAGGTTTAACCAGAATAATCC
GCTGACTTCAACAAGGATAGAAGACCACCAAGAGAAGATGCTGGAATTATGAGTAGACAA
GCTTTCGGTAAAGGTGAGGTCCTCAAGGAAGAGGATAAGAAGGATGAAGTTAAGAGAGAA
AGACCAACTTATGGTAAACGTAGAGATGACGGTGAAGATACAGGTTTCATGTCTAGATCA
GCTATGGGAACCTAAAAAGCTGAAGAAACCAAGGGAGGTTTAGGACCAAGAGGAGTACCC
TCAACTACCGGTGCTGCTACTACTACTAAGTAAGAAGGCGGTGCCCCAGAAAGATGGAGA
CCATAAGGAGCTCAAAAGACAACTACAACTACCACTACTGCTTCAGCAGGTGGAGATTCT
GGATTTACTAGAGGTCCTCCCAGAGCATCTCAACAAGCAAATACTAACACTGCTCCCACA
ACTCAAAACAGACCAGCTCAAACTAAGCCAGCTCCTCCTAAGGAAGATGGTGGTAATCAA
TGGAGAACTACCAAGAAATGA


>Contig721.1.g109(protein)
MSYINPENALKHAQEFKAEGNIEGALEELHQALHGKKFKGNNIILERIMLEMIDICSDQL
STAYLKEDIGHFRNVCQHTNMSLLENVLKTLKARTDQILIKIEEQEGEEKLRQVLSDDSA
QNLSLNTGDGDINPEDLIVMANCQFHQIEAKNKIMPSVNFFIDVCKIILDTLRQNSKMLD
FYNQTAQKCFEFCAKYNYKSEYQKISETLHSHFNQILKQAKHPETLIQSKIPFPVKLDED
DALQKVLELRYQQLKIALKMKVWSDAFRTSENIYQLINRNKHQHHASRMKQILADFFQNL
ALIFWESDFYLFHAYSLMNLQSINKASKTMSEQQKSSMAAQFVLATLSIPLDNKLSNFER
LNVQYIPQGMNEFFDESSQIRNELFGIASMLQVKGIPSRASLINYLKIKNLHLNQEFPQI
QELFRLIEEEESPFNISKRGKIIIDELMAIPNTNWSQYKDFIIKTLSVRILQKCKNYFKN
LKIQSLSKLLIFFNSFTEIESLLYECNRQNLIQTVIDYQTQSITFNQEVEVANNLLKFGH
KLKEAFQRVQDVMSEGKERERIFMKVKEKMEQEMNDVLKRKVDMVKMKENIARTQAEEHK
SLQDLFQQQQSEKEKEFNQQRVKEEKERQKNKLLEELEVMRKIRAQEVVQELLRKNIKKI
NGIKIDKQGQDQELDYDTIMNFYQNLLRKEKEQFEVVKKQKLKDTDHWARALREEEKVVI
EKYCAEHGEEEMKQIQKAIADRNEKELKMRLALERAYPVYQRFREDVMTVRKVEFQNKMK
EFIDKKGNELKEDLLSQALRELKKIENIRKVQDAEKARKERDAKISAEKKAKGITEETLE
EDGTLGIGWGRGVKVQPEQSADFNKDRRPPREDAGIMSRQAFGKGEVLKEEDKKDEVKRE
RPTYGKRRDDGEDTGFMSRSAMGTQKAEETKGGLGPRGVPSTTGAATTTKQEGGAPERWR
PQGAQKTTTTTTTASAGGDSGFTRGPPRASQQANTNTAPTTQNRPAQTKPAPPKEDGGNQ
WRTTKK