Identifiers and Description

Gene Model Identifier

Contig5734.0.g8

Standard Name

EIF2S3

Aliases

Contig5734_0_g8

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam09173 ) Initiation factor eIF2 gamma, C terminal
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam03817 ) Malonate transporter MadL subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003900409.997093137033517e-262eukaryotic translation initiat
ion factor 2 ga...
SGDYER025W9.997093137033517e-262GCD11 SGDID:S000000827, Chr V
from 205251-206834, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5734.0.g8(coding)
ATGAACAACTAAGTACAAGAATTAATAGACATTCAGGATAAACTGCAGAAAGAGCAGGAT
CATTTGGCAATGCAGAACATCGACACCAACATTGCCGAGTTGACTCCACTTACACCCGAG
ATCATCTCCAGGCAAGCCACCATTAACATTGGAACTATTGGGCATGTCGCTCATGGTAAA
TCAACACTCGTCAAATCCATCTCAGGTGTTAATACCGTTCGTCATTACAAGGAGAGATTC
AGAAACATCACTATTAAGCTTGGTTACGCCAACTCCAAGCTCTATAAGTGCCCTACTTGC
CCACCCCCTGACTGCTTCAAGTCCTTCGGTTCCTTCAAGGAAGACTCTCCTAAATGCACC
AGTCCAGGTTGTGAATCCACTTTATTACTTATCAGACACGTTTCCTTCGTGGATTGCCCA
GGTCACGATGTCCTGATGGCCACTATGCTCGCAGGAGCAGCTGTCATGGACTCTGCACTC
TTGCTCATCGCTGGAAATCAGCCATGCCCACAACCTCAAACCAGTGAGCACTTGGCTGCT
GTTGAAATCATGAGACTACAGCACATCATTATCTTGCAAAACAAGATCGATATTATTATC
AAGGACCCAAGTGCTGCCAGCAAGCAATTCGAAGACATTAAGAAGTTCGTGCAAGGCTCT
ATTGCTGAAGGAGCCCCAATCATCCCCATTTCCGCAGTCATGAAGCTCAATATCGATATG
GTTGTTGATTACATTTGCAGAATTCCCATTCCCTTGAGAGACTTCACAAGTGCTCCATAA
ATGATTGTCATTCGTTCTTTCGATGTCAACCTTCCAGGAGAAGACGCAGAGACCCTAGTT
GGTGGTGTTGCTGGTGGTACCATTTTGAAGGGAGTGCTTAAGGTTGGCGATGAGATTGAA
ATTCGCCCTGGTATGATCAGAAAGGACTCCAAGTCAGGGCAGGTGTCTTGGGAGCAGATT
TACTCCCGTATCACCTCCCTCATGGCAGACAAGAACCACTTGATGTACGCAGTACCAGGT
GGTCTCATCGGTGTGGGTATGAAAGTAGACCCCTACATCACCAGATCAGATAGATTAGTT
GGTTAAATCATTGGACACCCAGGCAAGATGCCAGATGTTGTAGTCGAAATTGAGACTTAA
TACTATTTGTTGAGAAGACTCCTTGGAGTCAAGAGCGATGGAGACAAGAGCAAGAGCAAG
GTCCAAAAGCTCAAGGTAGATGAGACCCTCATGATCAACATTGGTTCAACTTCCCTTGGT
GGTAAAGTTATCTCATTCAACACAGACGTAGTAAGAATCCAATTCATAAGTCCAGTGTGC
GCTAACGAGGGCGAAAAGATTGCTATGAGTAGAAGAATCGACAGAAATTTCAGACTTATT
GGGTGGGGTCAAATCAAGAAGGGCTACACTTCCAAGTCAAAGAAACAATGA


>Contig5734.0.g8(protein)
MNNQVQELIDIQDKLQKEQDHLAMQNIDTNIAELTPLTPEIISRQATINIGTIGHVAHGK
STLVKSISGVNTVRHYKERFRNITIKLGYANSKLYKCPTCPPPDCFKSFGSFKEDSPKCT
SPGCESTLLLIRHVSFVDCPGHDVLMATMLAGAAVMDSALLLIAGNQPCPQPQTSEHLAA
VEIMRLQHIIILQNKIDIIIKDPSAASKQFEDIKKFVQGSIAEGAPIIPISAVMKLNIDM
VVDYICRIPIPLRDFTSAPQMIVIRSFDVNLPGEDAETLVGGVAGGTILKGVLKVGDEIE
IRPGMIRKDSKSGQVSWEQIYSRITSLMADKNHLMYAVPGGLIGVGMKVDPYITRSDRLV
GQIIGHPGKMPDVVVEIETQYYLLRRLLGVKSDGDKSKSKVQKLKVDETLMINIGSTSLG
GKVISFNTDVVRIQFISPVCANEGEKIAMSRRIDRNFRLIGWGQIKKGYTSKSKKQ