Identifiers and Description

Gene Model Identifier

Contig7793.0.g5

Standard Name

EIF2S1

Aliases

Contig7793_0_g5

Description

Eukaryotic translation initiation factor 2 alpha subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • eukaryotic translation initiation factor 2 complex (IEA) | GO:0005850

Molecular Function

Domains

  • ( pfam07541 ) Eukaryotic translation initiation factor 2 alpha subunit
  • ( pfam00575 ) S1 RNA binding domain
  • ( pfam10447 ) Exosome component EXOSC1/CSL4
  • ( pfam01227 ) GTP cyclohydrolase I

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJR007W2.0009381340492598e-66SUI2 SGDID:S000003767, Chr X f
rom 451020-451934, Genome...
T. thermophilaTTHERM_008480901.9992362000979228e-56Eukaryotic translation initiat
ion factor 2 al...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7793.0.g5(coding)
ATGGAAGCACTCGCAGATAAAGATATAGACCACATCGAAGAAGTCGAAGACTCAGATGAA
GACGACCACGTTAATAACGAGAAACTGCAATGCAGATTCTACCGCAAAGATTTCCCAGAG
GAAAATGACCTCGTTGTGGCTTAAATCACTAAGACTCACGAGAACGGTGCCTACGTAATT
TTGCTAGAATATGAGAACTTAGAGGGACTTATTTTGTCAACTGAAGTCACAAATAAGCGT
GTGAGGCAGATCAATAAATTCTTGAAGATGGGCAAGAAGGAGACCATGATGGTACTTCGT
GTAGATAAAGATAAACGCTACATCGATCTCTCAAAGAAGAAAGTACTCGCCACTGATGCC
TTCAAGACTGAAAAGTTCTACAAAAAAGCAAAGATGGTGCATAATATTTTGAAGCAAGTT
GCCACCAAGCTCGATTGCTATTTATTAGAGTTATATGAGGCCTTTGGTTGGGACCTCTAT
GATAAATATGACCACGCTTATGATGCTTTCAGACTCATCATGAATGAGCCAGAACAAGTT
TTCTCTCAAATCAAGCTCTCCGAAGAATAAAGATAGGCTCTAGTGGAAGCCATTTCAAGA
AAGATGGCTCCATCACCAGTCAAAGTCAGAGCTGACTACGATTTGAACTGCTTCACCACT
GAGGGTATTGATGCCATCAAGCATGCACTTTTAACTGCAAAAGCTGCAGTCAGTGATGAA
AACATTCAAGTAGCTTTCAAATTGATCGCTCCACCTCACTATAAATGCGAGTGCATTACT
CTTGACAAAGTAGGAGGCATTGCCAAGCTAGAGTTAGCTCTTGAGATTATCGAGAGAGAA
ATAAAGGCAAAGAACGGAACCTTCAAGCTAGTCAACAAGCCACAAGTGATTGGTGCTAAG
GATGACAAGGACATCATTGAAATCATGGACAAGATAAATGAAGATGAAGAGGGAAGTGAA
GGAGAAGAAGACAACGACGAAGGAATGGGAGACCTCGATATTGAAGACGAAGATGATGAT
GGAGAAGAGAGAAAAGAGGGTAAGAAAGCAAAGAAGACCAAGAAAAGTTCAGATAATGAA
GAGGAAAGTGACGACGCATGA


>Contig7793.0.g5(protein)
MEALADKDIDHIEEVEDSDEDDHVNNEKLQCRFYRKDFPEENDLVVAQITKTHENGAYVI
LLEYENLEGLILSTEVTNKRVRQINKFLKMGKKETMMVLRVDKDKRYIDLSKKKVLATDA
FKTEKFYKKAKMVHNILKQVATKLDCYLLELYEAFGWDLYDKYDHAYDAFRLIMNEPEQV
FSQIKLSEEQRQALVEAISRKMAPSPVKVRADYDLNCFTTEGIDAIKHALLTAKAAVSDE
NIQVAFKLIAPPHYKCECITLDKVGGIAKLELALEIIEREIKAKNGTFKLVNKPQVIGAK
DDKDIIEIMDKINEDEEGSEGEEDNDEGMGDLDIEDEDDDGEERKEGKKAKKTKKSSDNE
EESDDA