Identifiers and Description

Gene Model Identifier

Contig20936.0.g50

Standard Name

EIF2D

Aliases

Contig20936_0_g50

Description

Translation initiation factor SUI1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR117C2.99851380290819e-19TMA64 SGDID:S000002524, Chr IV
from 685643-683946, Geno...
T. thermophilaTTHERM_000524300.000000019990673443141236uncharacterized domain 2 famil
y protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20936.0.g50(coding)
ATGATGGATAAAATTCAGGGGTCGAAAGCAGTGATCTATTCCCGCCAGAAAGTTCCCTTG
ATGTTCTGCCCTGACGCGAAATTAGGCTCATATTTTCCCACTATATACATGTTGTTCTAA
TTTCAAGAGAGTGGTCTGCTCAAATGCTTCTTGAAGACTGGAGTGGAGTCATATATCTTC
AATGGGGCTGATCTTATGTGGCCAGGCATCAAAGCGTTTGGCGAGGAACAATTTAAAGTC
AATGATATTGTCGTCATTTATGCCAAGAATTAACATTCATTAGCATAAGTGGGTGACGAA
GCTTATATACCTGTAGCAGTGGGAAAAATGCTTGCAAATCAAATTCCTGATAACCTGAAA
GGTAAAGCAATTCAAGTTGAACACTACCTATATGACGAATTATGGAATATGGGACCCAAA
AAAATTCCAATAGAAGTAAAAATCAATAGGGATGGTGAGAATGCAAATGACTCAAGCCAA
GCTGATACCTAGCAAGAAACTTAATCGAAAATTGAGGAAGTTAAAAACGACTAAGCTTAG
TTGAATAACTTAAATTAAGTCGAAGAAGAGAAAAAATCTTATGAAGCTGATGAAAACGGA
AACACTCTCCAAAATGATTAAAATGAAGAAGAAAAAAATACTACAACTGTACAGTCTGAT
TAAGCAGTACCAGAAGAAGAAGGACTTGAGGCCAAAATACCAGCTGAAGAAATGGATCCA
AGAATAGTAGAAGCATTATTCAGGGCAATATTTGAGGACTTTTAAGATTCAGAAATGCCT
ATGGAGCCATCTGATTTGTAAAAAGATTATCTTTGCTTATATTCTGATATCAATTATAAA
CTAGATTTTAGGTGTTCTTCGTTTAAGAGAATTGGAAAATTCTTAGAAATAATGCATAAA
AGAGGTATCTTAGATTATTCTGAACCAAAAGGAATAAATCATAAAGTTATAACCAGAATT
CACAGAGCTAACGAAGAGCTCAAGTCTTTCGAACCCAAATATTCATTAAGAAAGAGTAAG
AAAGTGGTTCTGGCTCCTCAAAATTAGGATGCAAAAGGAGTTAGATACCCAAAAGTCGAA
ATATCAGAAGTGTTCTAATTAAATAAAAATCTCAATTGTGTTCTATAAAACGTCAAAAAT
ATGAATAAGAGCTAGAAGTATTTCAACTTGAAGGAATTGAGAGATTTGCTTACAGATTAC
GTCAAGGAAAACAATCTTGAAAATTTTGCAACAAAAGGCTCTGTGAAATTAGACCCAATT
CTTAATTAAATAATCTCAAACCGAAAAGTGATAAATTCACAGAATGAAGTATCCAAGGAT
AATTTATATAAAGCTATTTTGGATCATATTATCGATTGCTATCAAGTAGTGCAAATTGAT
GAATAAGAAATAATCAAGGATAGAGTAAAATTCTTCAGAGGAGAAATTCCCATGGTGAAA
GTTCAAGCAAAACGAGTTTAAAATAAAAAGCAGACTGTGATTACAGGCCTTGAACTCTAT
CAAATTGACTATGATGAGCTAGTTTAGTACTTGCAAAATAAATGTGCTGGTTCAGTTACC
ACACAGGAGACTGAAAGCTCTATTGCTAGTGGTGCTAAGAATCCTAAGTAGGCTGTGCTG
GTCTAGGGCAATCATCTTGATTTGATATCAAAAGATATATTGCCTAAGAGATACTTTGTT
CCAGAAAAGTATATAATTAAGGTTGATGATATCAAAGGCAAAGGTAAAAAAGGGAAAAAG
TGA


>Contig20936.0.g50(protein)
MMDKIQGSKAVIYSRQKVPLMFCPDAKLGSYFPTIYMLFQFQESGLLKCFLKTGVESYIF
NGADLMWPGIKAFGEEQFKVNDIVVIYAKNQHSLAQVGDEAYIPVAVGKMLANQIPDNLK
GKAIQVEHYLYDELWNMGPKKIPIEVKINRDGENANDSSQADTQQETQSKIEEVKNDQAQ
LNNLNQVEEEKKSYEADENGNTLQNDQNEEEKNTTTVQSDQAVPEEEGLEAKIPAEEMDP
RIVEALFRAIFEDFQDSEMPMEPSDLQKDYLCLYSDINYKLDFRCSSFKRIGKFLEIMHK
RGILDYSEPKGINHKVITRIHRANEELKSFEPKYSLRKSKKVVLAPQNQDAKGVRYPKVE
ISEVFQLNKNLNCVLQNVKNMNKSQKYFNLKELRDLLTDYVKENNLENFATKGSVKLDPI
LNQIISNRKVINSQNEVSKDNLYKAILDHIIDCYQVVQIDEQEIIKDRVKFFRGEIPMVK
VQAKRVQNKKQTVITGLELYQIDYDELVQYLQNKCAGSVTTQETESSIASGAKNPKQAVL
VQGNHLDLISKDILPKRYFVPEKYIIKVDDIKGKGKKGKK