Identifiers and Description

Gene Model Identifier

Contig13824.0.g100

Standard Name

EIF2Bb

Aliases

Contig13824_0_g100

Description

Domain found in IF2B/IF5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01873 ) Domain found in IF2B/IF5
  • ( pfam05129 ) Transcription elongation factor Elf1 like
  • ( pfam13945 ) Splicing factor, salt tolerance regulator
  • ( pfam02645 ) Uncharacterised protein, DegV family COG1307
  • ( pfam09526 ) Probable metal-binding protein (DUF2387)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007807004.001714826231863e-32Domain found in IF2B/IF5 famil
y protein
SGDYPL237W2.0008113830639685e-30SUI3 SGDID:S000006158, Chr XVI
from 100496-101353, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13824.0.g100(coding)
ATGTCAGACACCGCAATCGCAGAGGACCAAATTGATACCACTACAGATCAACAAGAAGAA
GACGTTGAAATCATTGATTTCTCACAGACTGCCAAGACCAAAAAGAAGGGCAAGAAGAAG
GCCAAGAAGTCAAAGACCGCCAATGCTGCCCAGGAAGCTACTGCTGAAGATGCTCAAGAT
AAGAAGGCAAGTTTGTTAGTTGCTGAGGGGCACACTGAGTACAACTACTAGGACATGCTT
GAGCGCATTTAAGTTTTACTGAGAGAAAAGAATCCTTAATCTGCAGAGGGAGCTAAGTTG
AACAAGAGTGAGGACCCATATGTTGTTAAGCTTGGTACCACTAAGACTGCCTGGTAAAAC
TTTGATGCTATGGTTACAGTAATCGATCGTAAACCAGAACATTTATTAAGTTATATCGCA
GCTGAGCTTGGAGTTGAGTGTGTTTTAGGACCCGAAAACAACCTTATTTTGCAAGGAAGA
TTTATGAGCAAGAAAATTGAAATTCTCTATAAGAAGTATCTAGAGCAATACGTGAAGTGC
GTTAATTGCAGACAGTATAATACTAAGATGGAGAAAGACCCCAGCACCAGACTTTATCAA
TTAGAATGCAAGAATTGTGGTTCCACCAGGTCAGTTGCCGCCATCAAGGCTGGTTATCAA
GCCGTCAGAAAGGGAGAGAGAAAGAAGGCTAGATGA


>Contig13824.0.g100(protein)
MSDTAIAEDQIDTTTDQQEEDVEIIDFSQTAKTKKKGKKKAKKSKTANAAQEATAEDAQD
KKASLLVAEGHTEYNYQDMLERIQVLLREKNPQSAEGAKLNKSEDPYVVKLGTTKTAWQN
FDAMVTVIDRKPEHLLSYIAAELGVECVLGPENNLILQGRFMSKKIEILYKKYLEQYVKC
VNCRQYNTKMEKDPSTRLYQLECKNCGSTRSVAAIKAGYQAVRKGERKKAR