Identifiers and Description

Gene Model Identifier

Contig6479.0.g31

Standard Name

EIF2B5

Aliases

Contig6479_0_g31

Description

Bacterial transferase hexapeptide (six repeats)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00132 ) Bacterial transferase hexapeptide (six repeats)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR211W1.999576471039937e-58GCD6 SGDID:S000002619, Chr IV
from 884727-886865, Genom...
T. thermophilaTTHERM_005305503.998395524589391e-34hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6479.0.g31(coding)
ATGGGAATCCATAAGTAACAAGAACATGGAACTTAATTCCATCAAGAACCATAAATTAGG
GCAAGCGCTAATGATCTTAGAAACTCATAAGAAATAAACAGAGAAATCTTGAAGAATTTC
AACGAAGAATCGATGAAACTGTTTTAAGACATGTAGAGTAATCCCTTAACAAATCTAAGC
CCTGACACATTCCAAGGCCAGTCAGCTTAAGAGCTTATAAAAAAATTGAGTTCTAATACT
ATAACAGAAAGAATGGATTAACGAATGGGATAGTAGCCCTGTAAGTGTAGAATCGAAAAA
GACAACTTTAAATTAATCATTAAAGCTAAATCCCTCAAGATTATTTCATTCTTGAATTTA
ATAGATAACTTCTACACAAAGATTATGAAAAATGAGTAATTAAACGGCAGAAACTTCACA
AGACTTGGACATCCATCTATTTAGATTATTGGATAATTTAATGAGCTTGTTTTACTAAAA
GACAGTGTATTTGATGATCATTAATTTATGACTGCTTCTAAGATCTAACTTAAAGGGCAT
TTTGCCTTTTGCAAATGGAAACTTATAAGAAAAGTTTTCAATGAAATGGGAGTATGTCAT
GTTGAAAATGCTCTGTTCTACAAATAGGGCGTACTTGCAAATATTTCAGCTCTCAATGAA
ACAGTTAATATTAAAGTCAAGCAATTCGCCTAGAAACATTTAGTGCTTTGTGAGGAACTA
GACCTCTCAGAGAAAAAACTGACTAAAATTAGAAATGATTATGCAAAAGATTCAAAAATA
GTTGACGAATGTATTTAAAGCTACACCAAGGCAAGCTAGTCAATTAATAATTACTAGAAG
CAGCTGGAATTAGAAATGAAATTCAAGCTATCTTACAAAAAAATGTAAGACACAGCAAGC
TAGGTAAGCGACGCCCTAGATAGTCTATGTGAGACTAGAGATAAATTTTAAAATTAAACG
TAAGAGATGATTAGGGAACTTTGGAGTCTAGATAGAAACAAAACTGAAATATTCAAGAGC
ACCATTATGAGTGTGGTTGATACTTACCATGAATTTGAGTCTCAAATTCAAACTTACTTT
GAAGAATGCATAAGGCAGTCTAATTAAAATCAGAAGAACATCATTTTAACATTGAATTCT
CAGAAACTCAGCTCAAGTAAAATTAGCCGCAGCTCTGAAGTATCTTCGGGACAGGAATCA
AACTCTGAAGAAGAGGAAAAGTTCTTTGACAAGCAGAGGAAGAGATCCATAAAGTATAAG
AAAGAGGATGTTTAGAAATTTATGGATTAATTGGGAATAGAAGAAATACAACTGAATTCG
CCGATAATGAGCAGAGACCATAGCGTTGGAGCTATAAGTAGAAATACTATTGGGCCGAAA
GAAATGAGAAGAGATTACTCGGTCCTCTCAGCGAAAGGGGATGACTAGTAAGATCACTAA
TTTTAGGGATCAGATGATGATTTTTCAGAAGAAAATTTTAATATGAGTGCGATAGATCAA
TAGAACATGAATGTGTAAAAGCTTCCTCATGAGTACTAATACTCACCTTAAAGAGACAAG
CCACAATCAAAATAAAAAGGAAATATAATCATTTTTAAGCAGGATGAAATAGAGAAACAG
GAATTTTCAATGAATCTTATCTCCTCCCCTAAATCTCAAACTTCCACATAAAACGACTCA
GTGTAAGATATAGCAATCATAGAAGTTCAATTCAATCAATATCAACAAAAGTACTAAGAG
AACAACAGACAAACTAATTTGATAATGTAAGGGGCTAAAGATTTCAGCCAATATATGAAA
TACATGCAAACTTACATCAGAACTTATCATAAACATCTGTAAACTATAATCGAAGAGCAG
TATGAAGATGCTACTCACATTACAAATGAAAGCTAAGAGCAAACACATAATGGATAGAGT
AATATGATTTAATAAACTGTGAAGAAAGTGAGACAGCTCAAGATTAAAAAGGAAAACAAT
GATATGATCTCAAGAATTTGGATGAGCCTAATCAACAATTTCAAATCGTATGTCAATTAA
TACGAATAACTCTCAAGTAGAATATAAGATCTCTCTTAAACAATGGAACAATTTATTGTT
CAGACGTTAGAAAAAAAGAATTAAATTACTGAAAATATTAAAGCAAAACAATCAAGTATT
AGAAAACTGATAGCTGAATCAAAATCTCTTGCCTAATAAATCAAATAAATTTCTCATATG
CAGCATAATGAAAAGAACTCTACTTAAGATATAGCTAAAATATCAACTTACAAGCAATAC
ATTCAATCATATTAGTCAATTAAGCAGAAATATCTCCCCTCTAATATTTCGCTCTCAAAA
CTTTAAAATGAGTAGCTATCTCAAGAAGACTATGAACAGCTCTAAAAAATGCTACCCATT
AAATATCAAAAGCTTTCTTAAGTTTAATCAGAGCTTAAAACCATCATAAAAGAATACCAT
CAGCTATTGAAATCTCTAGAGCCAATAAAATCTTAAGCCAAAGAAAAGATCATTGACATA
AAATCTGAACTTATGATTTCTCATTAGGAGAGAAGCAAAAACTCATAAACTTTCTTCAAA
AACCTGATAGAATCAATTGAATAGAGTCTTTTTACAGAGATGGAAAATAGCGCAGAGGAT
GGAAGAGAAGATTACTCTAGTAATATTTTATCTTAACATCAAGATAGTGGATCGAAAATT
TATGATGTGGTATTTCACAAAAAAGAGTGCATGTATTATAATCCTTAAGACTTAAAATCA
GGATCTTAAGAGAAATCAAATTCTGTATCACCAGCTAAAAAATCAATAAGCAGAGACGAT
AACGATATTTATTCTTAAAATGCAAATTAAATAGAAGGCTTATAAGAAGAGCGCTTATAT
GAATTTAATTCCACTAACGTTTTGAATAGAAATCGTTCAAAAAGTGCTTACAAACCTTAA
AATGACAATCAGATCTAAGACTTCTTGCCAAACCTATTGAATAATGACTCTCAAGATTAA
ATGCCTAAAAAGCACAACTATAGCTTTAACTTTGGCAAATAAGTAAATATAATCAACAAC
TTTAACTCAAACCGGTCTTCTTTTGACTAGAATCCTCCTTAGGACCCCTAAATCAATAAT
AGTTCTCAAAAAGGCCTTGAATCTGCAAATTGGTTTAATAAAGCTCTTTCAGTTTTCTAT
CAAGAATGGAAATCATCTCAAGTCTTCTAAAACTTTATTTTGAAGGAAATTTACTTAGTC
GCAAATAAGGGCAGGCCTAAGGTGCTTTCAGAGATAGAAGTGCACAAAGTTACACTTCAT
GGAAAAGCTCCAGAATTTTAAAAGATATAGAAGTTGGATTCACATCCAGATGATTTCTTA
CATGATATAGACTTATCGTTAAGAGGTACAGTGGAAGTACTCATAAAAACTGAAATTAAT
ATTGATTGGGGACTGTAAAACTATTACAAGATTCCTATAACAGTAAATATACTGCTAAGA
AGTATAAATGGAAAAATTAGAGTATTCTATTCTAATGATAAAACAAAGGGATCATGGTAT
GGTTTCGTTGGTAAACCAGTAATTAAGCTTAATTTAGACCCTGTGATTGGAAAAGATAAT
AGGTTTTCAATCAAGTATATTCCTAAACTTCGAGAATTGATTGAAGACTTGATTGGCAAA
AGATTTGATAAGTACTGTTTACCAAATAAGCGACCCCTCTCAATACCTGCTCATACCTAT
GAAGAGTTTGTTAAAGGAGGTCTTTAGGCAGTCATCATTGCAGAAAGCTTCCAAAACAAG
TTCAAGCCAGTATCCCATGAAAAGTTAAAGTGCCTGTTCCCACTTGCCAATGTCCCTATG
CTTCATTATGTGATTGAATTCCTATTAATGAATAAAGTGACTGAAATATTTATTGCTGTG
TGCATTCATAGGTCGCAAATTGATAAGTTCCTCAATGCTTAAAAATACAAAGGGGTTAAG
ATCAATGTGATAACACTAGAAAGTAGTGCAAACCTCGGTGATGCTCTCAGAGAAGTCAAT
CAGCTTTAAACCATTTAGCATGAGTTCATTCTGTGTAGAGGGGACATCATAACAAACGTC
AATATTCATCAGGCAATGAAGGAGCACTTCAAAATAAAGGCAGAGGACAAGGAAAAGAAG
TTAGTTCTCACAAAGTTGTTTGTCAAAGTTCCATTCTCGAATCCTATTAGAAATAAGTAA
CAAGAAGTGGCTTTAATCTTAGATGATTAGACCAAGGAAATCATGAAGTATGAATCATTC
ATAAATAACAAGTCTCTTAAGATTAATGAAGAGTACATCTCAATGAAGCAGTCTCAAAGA
AAGTACTAAATTAGATTTGATTTAGTAGATTCAGAAATCAGCATATGCAGTAGAGATGTT
CTGAACTACTTCACAGATAATTTTGATTATGAAAACTTAAACGACGACTTCATCAACCAA
ATCTAGTCAAGTGAAATCATTGAGGATAGAATCATAGCTTATGAAATGAATGGCTATTTC
GCTAGAATCCTTGATCCTAGAACTTATGCAGAAGTTACTTAAGATATACTTTCAAGATTC
TTACATCCATTTGTCATTGATTCGAAATTGCTCTTCCCAAATTCAAACTATCATTTCTAG
AGCTTCAACAAATACTTAGAAGGCGATGTTTAAATTGGTCTAGGGTCAACTATCTCAAAT
AATTGTTAGGTCGCTAAAGGCTCTAAAATTGGAAATCATACAGCTATCGATAGATCAACT
ATTGGAAAGAATTGTCATATTGGAAATAATGTGACTATCAGAAACTCATTTATATGGAAT
GATGTAAAAATTCATGACGGTTTCAAAGAAGATCAAACTATTCAAGCTGGGTCAATGGTC
AGCAAGTATACTTACAACTCAAAGACTTTAAAATTTGAAGAAAGCGAAAAAAATTAATCG
GAAATCTTTGAAGTTGGTTGTATTTCATATTTACCCAGAGAATGTTAGTTAAAAGAGGAT
GAGATTATCGGTAGTAAGCATCAATAAGAAGATGAGGAGAGTGATTTTGAGGATGAAGAA
GATCACGAGGAATAAAAGTCAAACGAAGCCTTTTTGAATGAAGTGAAAAAGACTATCGAG
AGAACTACAGATGATCAAATCTCCAATGCAGTGACTGAAGTGAAATCATTAAGAATGTCC
TACAACAAAGATCAATCTGACTGCATTGAAGCATTTATTCCACCACTTCTTGACAAAATA
ACAGAAGAAAACCTCCAAAAAAGATCTAAGCAACTACAGGATCTCTTCACAAACTGGAAA
GATTTACTTGTGGAATTCATGAGAGCAGATGCTGACGAGAAAACCTTCATTCAATTCTCA
TTGATAAGAGCCATAGAGATATACTGTGCTACTCATGAGCTTTTCAACAACACTTTCCAT
ATTATCATGCAGATTATCTTCCAGCATAAGTTCATTGAAGGCGGCATATTCATTAAATGG
AATCAGTAAGCTCAAAAGAGTATCTAAAACCTCACCAAAGAGGATGAAATTTAAGACGAT
ATCTTCGATTTTATTGAGTCAAGCAAGAGAGAAAAGTTCATTAAAGATATGGCCAAATTT
ATTGAATTCCTTGAAAAATCCTTAGAAGAAGGAGAGGAGGAAGAGGAAGAATATGACGAA
GAAGAGGGAGCAGAAGAGGAGGAAGAAGAAGAAGAGGAAGAAGATTAATGA


>Contig6479.0.g31(protein)
MGIHKQQEHGTQFHQEPQIRASANDLRNSQEINREILKNFNEESMKLFQDMQSNPLTNLS
PDTFQGQSAQELIKKLSSNTITERMDQRMGQQPCKCRIEKDNFKLIIKAKSLKIISFLNL
IDNFYTKIMKNEQLNGRNFTRLGHPSIQIIGQFNELVLLKDSVFDDHQFMTASKIQLKGH
FAFCKWKLIRKVFNEMGVCHVENALFYKQGVLANISALNETVNIKVKQFAQKHLVLCEEL
DLSEKKLTKIRNDYAKDSKIVDECIQSYTKASQSINNYQKQLELEMKFKLSYKKMQDTAS
QVSDALDSLCETRDKFQNQTQEMIRELWSLDRNKTEIFKSTIMSVVDTYHEFESQIQTYF
EECIRQSNQNQKNIILTLNSQKLSSSKISRSSEVSSGQESNSEEEEKFFDKQRKRSIKYK
KEDVQKFMDQLGIEEIQLNSPIMSRDHSVGAISRNTIGPKEMRRDYSVLSAKGDDQQDHQ
FQGSDDDFSEENFNMSAIDQQNMNVQKLPHEYQYSPQRDKPQSKQKGNIIIFKQDEIEKQ
EFSMNLISSPKSQTSTQNDSVQDIAIIEVQFNQYQQKYQENNRQTNLIMQGAKDFSQYMK
YMQTYIRTYHKHLQTIIEEQYEDATHITNESQEQTHNGQSNMIQQTVKKVRQLKIKKENN
DMISRIWMSLINNFKSYVNQYEQLSSRIQDLSQTMEQFIVQTLEKKNQITENIKAKQSSI
RKLIAESKSLAQQIKQISHMQHNEKNSTQDIAKISTYKQYIQSYQSIKQKYLPSNISLSK
LQNEQLSQEDYEQLQKMLPIKYQKLSQVQSELKTIIKEYHQLLKSLEPIKSQAKEKIIDI
KSELMISHQERSKNSQTFFKNLIESIEQSLFTEMENSAEDGREDYSSNILSQHQDSGSKI
YDVVFHKKECMYYNPQDLKSGSQEKSNSVSPAKKSISRDDNDIYSQNANQIEGLQEERLY
EFNSTNVLNRNRSKSAYKPQNDNQIQDFLPNLLNNDSQDQMPKKHNYSFNFGKQVNIINN
FNSNRSSFDQNPPQDPQINNSSQKGLESANWFNKALSVFYQEWKSSQVFQNFILKEIYLV
ANKGRPKVLSEIEVHKVTLHGKAPEFQKIQKLDSHPDDFLHDIDLSLRGTVEVLIKTEIN
IDWGLQNYYKIPITVNILLRSINGKIRVFYSNDKTKGSWYGFVGKPVIKLNLDPVIGKDN
RFSIKYIPKLRELIEDLIGKRFDKYCLPNKRPLSIPAHTYEEFVKGGLQAVIIAESFQNK
FKPVSHEKLKCLFPLANVPMLHYVIEFLLMNKVTEIFIAVCIHRSQIDKFLNAQKYKGVK
INVITLESSANLGDALREVNQLQTIQHEFILCRGDIITNVNIHQAMKEHFKIKAEDKEKK
LVLTKLFVKVPFSNPIRNKQQEVALILDDQTKEIMKYESFINNKSLKINEEYISMKQSQR
KYQIRFDLVDSEISICSRDVLNYFTDNFDYENLNDDFINQIQSSEIIEDRIIAYEMNGYF
ARILDPRTYAEVTQDILSRFLHPFVIDSKLLFPNSNYHFQSFNKYLEGDVQIGLGSTISN
NCQVAKGSKIGNHTAIDRSTIGKNCHIGNNVTIRNSFIWNDVKIHDGFKEDQTIQAGSMV
SKYTYNSKTLKFEESEKNQSEIFEVGCISYLPRECQLKEDEIIGSKHQQEDEESDFEDEE
DHEEQKSNEAFLNEVKKTIERTTDDQISNAVTEVKSLRMSYNKDQSDCIEAFIPPLLDKI
TEENLQKRSKQLQDLFTNWKDLLVEFMRADADEKTFIQFSLIRAIEIYCATHELFNNTFH
IIMQIIFQHKFIEGGIFIKWNQQAQKSIQNLTKEDEIQDDIFDFIESSKREKFIKDMAKF
IEFLEKSLEEGEEEEEEYDEEEGAEEEEEEEEEEDQ