Identifiers and Description

Gene Model Identifier

Contig17726.0.g111

Standard Name

EIF2B4

Aliases

Contig17726_0_g111

Description

Initiation factor 2 subunit family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam01008 ) Initiation factor 2 subunit family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009319501.999576471039937e-58Initiation factor 2 subunit fa
mily protein
SGDYGR083C1.999534248571833e-46GCD2 SGDID:S000003315, Chr VII
from 646815-644860, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17726.0.g111(coding)
ATGGAGCAGAGTCAAAAAGATATACCAGCTTCCTCTTCCCAAACAAATGAGGAAATTAAA
CAGTAGAAAGTTCAGCAACAGTAATAACAATAAAAGAAGCAACCTAAGGAGAAGCCCTAA
AAAGATGTTGGCAAGATGATCGACAGTGGTAAAACTCTGACCGCTGAGGAAAAGTAAGCA
CTTAGAAAAGCAAAGAAAGAGGAAATGAAATAAGCGAAGATGCAAAAGACACAGTAGAAA
TTTGAAGCCGGAGACGAACAGGAAGAAGGGAAAGTTAGTTAGGAAGAAGCAAATGCTTCA
AAAAAAAATCAAAAGAAATAAGGAAGTGCTAATTAAGCTCAATAGGACAATAGCAACGTA
TAGGTTGAAAGTTAATCTTAACAACAAACTGCATTTTCTGCGATGAGAAATTCTTTAGCT
GCAGATATCTAGGAACCTGCTCAATCTACTACAACTTAGGGATAAATTTAAGAACAGAAC
ACTTAATAAGTTCCCAATTTATAAACCCAATCCAGCTTAGCTCCACCCTCAAACACTTCC
CGCACAGAGCAAAGAGGCCGTACTGGATCGTTTTTCTCATATTATTCAGCAAACACTCAA
GAGAATATTAAACATCCGCAAAATGCTGTGCAACAGGAACTTAATCAAGCTGGGTCTATT
AAGGATATTGCGCTTTTCAGCAGATTGGCTACTTTCAAGGAATAAAAAGACTACATGGAT
TAACATAAACATCTGCATCCAAAAATAAGAGAACTTGGCATGCGTATTATTAATGATCAC
TACGCTTCTAGTAACACTCGCTGTATCGCAATGATTCAAGCTTTGAAAGCTTTCATTAAT
AATTTTTAAGTACCTAGTAATAGATCCCTTAATAGAGAGCTAGAAAGTTAGCTTGATTAA
ATAATCTAGTTTTGGGTTGGTTGTAAACCATTTACAACTGGGCTTGAAACTATGACAGAT
TACATCAAGATGTCAGTTGCACAGCTAAACACAAAGCTTACTCAAGAATAATAAAAGAGG
ATCATCACAGATAAATTGGATAATTTCATTGCAGATAAAATCATAGCTGCAGATGAGACT
ATAGTTTAAAAAGCCATGCAAGTATTTTCAGATACTGAGGAAGAACACATTATGATTATG
GGAGGCGTTTAATTGCTTTAAATGATCTTTATGGAAGCCAAAGACTAAAATAAGAAATTC
AGAGTAATTGTTACTGACACTAGCCCAGAATTTGAGGGCAGAGAAATGGTTAAAAGGTTG
AGTAGCTATGGTATTCAATGCACCTATACCCTTATTAGCGGTATCAGTTTCTTAATACAC
AAGGTTACAAAAGTATTTATTGGAGCTTCCAGTGTTCTTTCAAACGGTGCTGTAGTTGCT
AAAATTGGAACTTCAATGATGACTAGCATAGCTGCAAAGCACTTAAAACCTGTCGTTGTA
TTTTCAGAAACCTATAAATTTTCTGATAGAGTGAACTTGGATGCTATCAACAACAATGAA
ATTGGAGATCCCTCTAAAATTGCAAACAATCTCAGTAGAAAAACAGGGCAGCAGGGTGGA
TTAACTTCTCAAAACGATTTGGGAGATTGGAGAAAGAATAATAAGCTTGTCCTTCTTAAT
TTGAAGTATGACCTCACACCAGCTTAGAACATTAATATGATAATCTGTGAGTTTGGTAGA
GTGCCTGCAATATCAGTGCCAGTAGTCATCAGAGAATCATAGAGAGAACTGGAGCTCAGT
TTGGAGAATGAGAATATGCTTTTTAATCTTGAGGAGAACATAACGTCTAATTCAAGCATT
CCATTGTGA


>Contig17726.0.g111(protein)
MEQSQKDIPASSSQTNEEIKQQKVQQQQQQQKKQPKEKPQKDVGKMIDSGKTLTAEEKQA
LRKAKKEEMKQAKMQKTQQKFEAGDEQEEGKVSQEEANASKKNQKKQGSANQAQQDNSNV
QVESQSQQQTAFSAMRNSLAADIQEPAQSTTTQGQIQEQNTQQVPNLQTQSSLAPPSNTS
RTEQRGRTGSFFSYYSANTQENIKHPQNAVQQELNQAGSIKDIALFSRLATFKEQKDYMD
QHKHLHPKIRELGMRIINDHYASSNTRCIAMIQALKAFINNFQVPSNRSLNRELESQLDQ
IIQFWVGCKPFTTGLETMTDYIKMSVAQLNTKLTQEQQKRIITDKLDNFIADKIIAADET
IVQKAMQVFSDTEEEHIMIMGGVQLLQMIFMEAKDQNKKFRVIVTDTSPEFEGREMVKRL
SSYGIQCTYTLISGISFLIHKVTKVFIGASSVLSNGAVVAKIGTSMMTSIAAKHLKPVVV
FSETYKFSDRVNLDAINNNEIGDPSKIANNLSRKTGQQGGLTSQNDLGDWRKNNKLVLLN
LKYDLTPAQNINMIICEFGRVPAISVPVVIRESQRELELSLENENMLFNLEENITSNSSI
PL