Identifiers and Description

Gene Model Identifier

Contig18132.0.g71

Standard Name

EIF2B2

Aliases

Contig18132_0_g71

Description

Initiation factor 2 subunit family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR291C5.998439611888618e-47GCD7 SGDID:S000004282, Chr XII
from 719462-718317, Geno...
T. thermophilaTTHERM_001939607.999101194912153e-45Initiation factor 2 subunit fa
mily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18132.0.g71(coding)
ATGTCAAGAGTGGACAATTTGGTTGAAAAAATCAAAAGAAAGCAAATCACAAGTAACCAT
GAGTTGGCATTGAAAACTACAGAAATCTTCAGAGACTTAGTGGACCAATCAAAATGGGCA
GATGCTCGTTAACTTTTCAAAAATGTGAGACAGATTGGCAAGAAACTCATTACAGCTGAT
AGAATGAATTTCACTGTGGGAAATGTAGTCAAGAGAATATATCATGTTATCAGAGAGGAA
TGCAAGAATCTTAAGATTAGTGTAAAAGATACCACTGATATTCTATCTGGAGTACCTAAA
GATTAAATTCGTATGGACTCACTCCGTTCAATAACCATGAGAAAGAACAATTCTAGAGTT
GGAGACATTGAAGATTCTCTGGACAAAATTGAAGAAGATGTAGAAGATATGGACGAGATC
AACAGCCCAAAGAAACAGTCCTCAACTAAAGGTTTGAGATATAATTCGTCAAACACAAGC
ATCGGCTCTAAGAAAATGTCAAGCATTAATCTACCATTAACTGAAACCTTGAATCTTAAG
CTCAAGAACGCTCTACTTCAAGCAATTGGGTTAATGATTGAAGATATTGAATCAGTGCAT
GATATGATTACTGCACAAGCCAATGAACATATTCACAAGGAGGATGTTATACTGACTTAC
GGAAAGAGTCAGATTTTAAGTGGCTTTTTTGAGGAGGCATCCAAAGATAAATTCTTTGAG
GTATTGGTATGTGAGACAGCGCCCTCCTATTCTGGTCATCAAACTGCAAAAGAGTTATCA
TCAAAAGGTATTTCTACTACTTTAGTTTCTGACTCATCTGTCTATGCTCTCATGTCTAGA
GTAGACAAGGTTATTATCTCAACTCACTCTATAATGGCAAATGGAGGATTAGTGACTCAT
TCAGGCGCCTATATGATATGCTTGGCCGCACAAGAACACTCGGTACCAGTTTATGTAGTT
GGTGCCTCATATAAAATGACACCTCTCTATCCCTTTGATTTCTTGACTTACAATGAACTG
TCCTCACCCTAGGAAATCTTTCACTTAGAAGAACACGACATAAAATCCAACATAGAGGTG
ATAATCCCAGCATACGACTACGTCCCTCCAGAACTGGTTAGTTTGTACATTACAAACATA
GGAGGCCAGACACCAAAGTACATCTACAGAGTGTTCACTGATTCTATGGAATTATAAGCA
GTAGTTGAATAAGACTAACCAGAAAGATATATCACAGTTGGAGTGAGAGTGCTAATTATC
AATGAAAAAGATTAAGTTTTTTTAGGCAGAAGACTTGATACAAAAGATAAATTGTATGGG
ACGCCAGGTGGTCACTTAGAATACTCAGAGTCATTCGCTTAATGCGCCTCCAGAGAACTC
TATGAAGAATTGAACATTTTAATTCCAGAATCAAATCTGCATTATTTAACCACTCTAAAT
GTTATTAAGAAGTCAAATGATTATGATCAAGCAAAACTGCACTATTTGAACATATTTATG
GTGACATTTATAAACATTGACTTAGCTCAAAACATAATAAATCAAGATTAGCATAAATGC
GAAGAATGGGAGTGGCTTGAGTGGTCAGATATTATAAATACAGATAAAAAGCGTAACTAA
CTTTACTACTCATTTAACTATTTATTTGAGCAGGGTTATGATGATTTAGACAAAATTAAG
TAACTAGTTGCGATTAAGCGGGAGTGA


>Contig18132.0.g71(protein)
MSRVDNLVEKIKRKQITSNHELALKTTEIFRDLVDQSKWADARQLFKNVRQIGKKLITAD
RMNFTVGNVVKRIYHVIREECKNLKISVKDTTDILSGVPKDQIRMDSLRSITMRKNNSRV
GDIEDSLDKIEEDVEDMDEINSPKKQSSTKGLRYNSSNTSIGSKKMSSINLPLTETLNLK
LKNALLQAIGLMIEDIESVHDMITAQANEHIHKEDVILTYGKSQILSGFFEEASKDKFFE
VLVCETAPSYSGHQTAKELSSKGISTTLVSDSSVYALMSRVDKVIISTHSIMANGGLVTH
SGAYMICLAAQEHSVPVYVVGASYKMTPLYPFDFLTYNELSSPQEIFHLEEHDIKSNIEV
IIPAYDYVPPELVSLYITNIGGQTPKYIYRVFTDSMELQAVVEQDQPERYITVGVRVLII
NEKDQVFLGRRLDTKDKLYGTPGGHLEYSESFAQCASRELYEELNILIPESNLHYLTTLN
VIKKSNDYDQAKLHYLNIFMVTFINIDLAQNIINQDQHKCEEWEWLEWSDIINTDKKRNQ
LYYSFNYLFEQGYDDLDKIKQLVAIKRE