Identifiers and Description

Gene Model Identifier

Contig21302.0.g1

Standard Name

EIF2B1

Aliases

Contig21302_0_g1

Description

Initiation factor 2 subunit family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam01008 ) Initiation factor 2 subunit family
  • ( pfam00455 ) DeoR C terminal sensor domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007870704.9995619603214884e-57Initiation factor 2 subunit fa
mily protein
SGDYKR026C2.000364041471746e-45GCN3 SGDID:S000001734, Chr XI
from 489655-488738, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21302.0.g1(coding)
ATGGTTGAACACTGGTCTGGAAAAACCTGCTCAGGGCTCATGTAGGAAACAGAAAAAGCT
TGTGAAAATCTTTTGGAATCTGCTAAAGATAATGAAATATTGAAGAACAAGACTTCTCTC
ACCATAAAGGCAGTATGCGCCATTTATAGAAGATTAGTTAAGAATGTTTGCCAAACAAAT
GACGATCAAGATATCGACATAATCAAGGAGAAGATTCATGAGAGAAGTTAAATATTGTGC
CAACATGCAGTCACTTCAAAGAACAGAATTGCATAAAATGCTAAAGCACTGCTTAGAGAT
GGAATGACTATCTTGATTCATGGTTAATCTTCAGTTGTAATGCACACTATAATTAAGGCT
TCTCAAAGAGGAATTAAATTGAATGTGATAGTTACTGAATCTCTAAACTTCTCAGGTCAA
AGTATAAAGAAGCAACTTGAAGAATCAAACATTCCAACTAAAGTTATTTAGGATGCTGCC
GTAGCTGTAGTAATGCCTTAAATTGACGCTATTTTTGTAGGATGTGAAGCAGTCGTTGAA
AATGGAGGTGTGATCAATAAAATTGGTACCTTCACAATTGCTCTAGTTGCTAAAACATTC
TAGAAACCTTTCTATGTGTTTACTGAATCGCTTAAATTCATGAAGGAATTCCCTTTGAGA
TAAGAAGATGCTCTGGAATTAGCTACTTCTGGATAGGTAGACATTGAGAAGTTATTAGTT
GATTACACACCTCCTGAATATATTTCACTACTCTTTACCAGTATTGGAATATTTACCCCT
TCAGCTGTTTGCGATGAACTTATAGAGTTCTTTTCAGGTTAATGA


>Contig21302.0.g1(protein)
MVEHWSGKTCSGLMQETEKACENLLESAKDNEILKNKTSLTIKAVCAIYRRLVKNVCQTN
DDQDIDIIKEKIHERSQILCQHAVTSKNRIAQNAKALLRDGMTILIHGQSSVVMHTIIKA
SQRGIKLNVIVTESLNFSGQSIKKQLEESNIPTKVIQDAAVAVVMPQIDAIFVGCEAVVE
NGGVINKIGTFTIALVAKTFQKPFYVFTESLKFMKEFPLRQEDALELATSGQVDIEKLLV
DYTPPEYISLLFTSIGIFTPSAVCDELIEFFSGQ