Identifiers and Description

Gene Model Identifier

Contig21094.0.g79

Standard Name

EIF2AK1c

Aliases

Contig21094_0_g79

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR283C5.999460549133178e-49GCN2 SGDID:S000002691, Chr IV
from 1030049-1025070, Gen...
T. thermophilaTTHERM_000525401.9998323414791308e-36Protein kinase domain containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21094.0.g79(coding)
ATGCCCACTCAAAACCAAACAAATTAGTAATAATAATAAATAGTTGAGAAGTAGGGTACC
CACAAACCCCTGAACTCTTAGAAGTCAGAGTAGATAACCCGCAAGTCTAAAAAAAAGAAG
GCAGTTGTTAGGAATAGTCACAAATAATTTAGCAATGAAGATAGCAATAATCTGATTAGT
AGTTCTCACAGTGATCCCTAACATCAAAGCCAATTGTTTCAATCTCAAAATAAGTTACAA
TAAAAGCATGACTAGAATAAAAGCGAGAGTCAGCTTATGCCTTCTGCAAGTATTCAAAGT
GTAACTTTTAGTTAAGCGCTTGAAAAAGACAATTTTGATAGCAAATCTATGATTAGTGTA
AGCAAAAGGAGTTAGAGGTCTATATTTGAGATAAATTCCCAAAAAAGTAGTAAATCTCAA
ATCTCTCAACCAAGCTTAATTTAACAACAATCCAATGCTAGCATGGATTCGTCATTCGAA
GTTAGAACTAATGAGTTGGAGGTTTTATAGAGTATTTACCCTGATGATATTGAAATAATC
GAAGAAATATCAGACTAACAAAAATCTCCTTTACAAAAGAGCGAGAAATCCCTCTCTCAA
ATTCCCGCTTAAAGCAAGGGCAAATTTAAAATCAGAATCTATCCGCACACAGTTTCTGAG
AACAATTTCTGCTGGCTAGACATGCTGATAACTTACCAAGATAACTATCCACATGCTATG
CCATTCATTTCTTTGTAAAAAGCCACTTCTAAGGGGCTTTCAGAGCTCAATTTTATAGAA
ATAGAGAGCACTATTTAGCTGAAATCCATCGAGTACTTATCGGATAAAGAGCCCTTTATC
TTCAAGTTGATAGTTATGGTTCAGGATTTGCTTGAAGGCATAAACTAAACGACTAGTTCT
TATAAGAGAAAGCAGTCTAAATAATCCAAGGAAAGACACTAACAGCATTTCTAAACTGAT
GAACGCTTGAGAGAGAATGACTCCAGAAACCCAGACATTGTTATCAATTCAGTGACCGAT
AACAATGAAACTAAGCATGAAAAGGATCTTGATGAACAATAAAACCCAAATGAGGAGGAA
TACAGCTACTATGATGAGGAGGATGAAGAGTAGTCGAGTGCAAATTAGACGTAAGATAAA
GCCGATTCAATGCAAAACACTCAGGAAATTATCAAAAATTAGATTAAACAGGAGGAGCAG
CTTCTGAGAGAGGGTATGGAGGGGAGGTAGCTGGAAATACAAACTCCCTCGTTTTAAAGA
GTTCCCTCCGCTTTTGACAACATTTTGAATAATTTACAGCATTTTCAAATTGATGAAGAT
GAGTCGTTAAGTTACCGAGCTATAAACCAGGCATCACAATTGTTATCACTTTCTCACCAA
TCCCGTTACAAATAAGACTTCGAAGAACTTGGTAAAATTGGCGAGGGAGGAGCTGGAAGA
GTATACAAAGCCAGACATAAATTCGACAGAAACATTTATGCCATCAAGAAAGTTAAACTT
TACAAGCATGATGAGGAAGAAAACGATAGAATCAAAAGAGAAGTCACTGTTATTAGCAAG
CTTCACAATCAGCATATAGTGAGATACTTCTAGGCATGGCTGGAACACATAGAAGACGAG
AAAGAGATAAAAGAACTGGCTTTCTCAGACTCAGAAGTAGAAGAGGAAGATGAGAAGTAT
GAAAATGAAACTGACAACAGTGACATGATTGACGACTCATACTACAACAGCAGGAAGCAA
CGCTGTAAAAGTCAGAGTGATAGTGATGCGGTCTCCAGAGACGAGGATGATGATGAGTAA
GATTACTATGTCGAAGACGATGAGGATGATGAAGCTGACTACTCTGAGTCAGCGAGTTGT
CAGAGTGATAGCGAGATTTATATCAGTGTGAGTAACAAGAAGGGCAAGAAAAGAGGGAAG
AAGGACAAACTTGATAAGAAACAGTATCAGTTCAAGAAGAAAGTCAATTATAACAAGGAT
AAATTGATTAAGAAAAAGCAGTAGAATATCAAAAGAAATCTGTTCAAAGAAAGACAGGAA
TAAGCTAAAATCAATCAATAAAAAAATCCTAAATATAAGGGTATTCAGGTTTTGTACATT
TAAATGGAGTTTTGTGAGGGAAACAGTTTGAGAAATTTCATTGATGAAAATCCTGGAAGA
GAGTAAGAAGAGAAGAAATGGAAAATCTTCTGTCAAATAGTGGATGCTCTGCATTACCTG
CATGGGCTAGGATTGATTCACAGAGACTTGAAACCCTCAAACATATTCTTGGATAAGAAA
TACAATGTAAAATTAGGTGATTTTGGACTAGCCACAGCACATCACCATCACCACCTCACA
GCTGGAAACACCATGAAACATATCTAAAGTCCAATGCAGAAGAACTTCACTGCTAAATAG
CAATCGAAATTCAATATTTACTAGCAGTTAAATCAGCAGTAATAACAAAGTCAGAAATTC
AATAATGCAAAGCAATAATTGAAATTAGATTTATCTTCATCTTAGGCATCGACTAATTTC
TAGCCTGATCAGCCTTAATTACATCTATCTTTTTCAAATTAAGCTCACTCAGTGGGTATT
GGTACTCCAGCCTATATGGCCCCAGAACAGGAAAAAGGTCATGGCAAGTACAACTTCTTA
ACTGATATGTTTTCGCTTGGCTTGATTTTCTTCGAAATGTGGATTGGCTTCTAGACTAAC
TTTGAGTAGATGAAAGCATTTTCATTAGTAAAGAATCAAAGTGTAATTGATAAGGAATAT
GAGAAAAGAATACCTGAGAATGCTAGAAAACTGATTATTTGGCTTACTAAGGAAAACCCG
AAGGAAAGGCCATCCACTTTGTAACTGCTATAAAGTGAATTGATGCCACAGAAGCTGGAA
GATGAAGTGTTTAAGAAATTTGCCTATTCTATATCTAATCAAAAAACAATTGAAAGTATA
TAACTTATGAATTTCTTGTTAAAACGCAAAACTCCCAAGAATATTGATCTAACATTTGAG
AGCTATATCTTTGATTAGGCCATGTAACAGCAGTCAGGCATTGGATTGAACGGATACAAT
GGTTATGGTTTAAATGCAACGTCTTCACATGGAAATTAGGGAGGTTATTTTGGATAGCTA
AATATAGGGCAAACTCTCTCAAGAGGGATTTAACCTCAAACATCATAATTAGGTTTCCGA
CAAGACATGAAGTTGCATCTTAGCGACAGAATTCAAAAAGAATCTATAGCCAAATCTATG
CTGAAAAATTCCTTTAAGTAGGTATTTGTGATGCATGGAGCTATGGACATCGATATACCT
ATACTCGCCCCTGTTATGGACTAGGCTACTATATTTGTCAGTTTGAGGCAGCAAAGGTTC
TCGCTTGATAGAAGAATGAGCCACAATTCAGAAGGATCAGGACCAGAGAATTTAGGTGGT
ACAGAAGACCAACTACACAACATAGAAGTTGATGTGCCGACTGGATTAGTAAAATTTTCT
GAGCAAACTGCAAGTGGTACTAGTGTCAACCATACAACTCCAAATGGTATTATTACAAGT
GGAACTAATAAGCAGCTGCTGATGTATTTGAAGGAGAGAGACATCTAAAAAGTTACCTAT
CTAAGCATAGACCCTCAGTTCAATGTCCAAAAAATATTGGATGATAGTGGATATGTCTTA
TAGCTTCAAAACAATCTTACAACAAATTTCGCCAGGTTTATAGCTCGAAAGCAGCTCCCT
TTCTTCAAACGTTTCCACATTGGCAAAATCTTCAAAAAGAACCAGTAATTCCAAAGAACC
ACCCCAGAAGAGCATTTAGAGGCTTCTTTCGACATAACAAGTTTGATGAGTGGCTCTCAC
TACACGAGCGGCGATGAAATTATTTATGAGGCTGAGGTAATAAAAGTTGCAGATTAGATT
GCTCAGAGTTTCAGTGGAATTTTAGGGAGAGGCTACAAGATAAAAGTTAGCTCCTCAGAA
ATTATAGATGGGATTATGGAGGAATGTCATATTTCAATTTCTAGGAGACATTTACTTATA
AGAGATTTGAGTATGAATCTTGACAAGGAGCCATGGGGCAACATTAAGAAAAGATTGATT
AAGAACGATTTAATTAATCAAGCCAATGCAGAGAGATTAGGAGAATTTTTGAAAATCAGG
GGAAGTATTGCATAGATTGAGTAGCAAATTAAAAATAATCGAAGTATGAGACAGGTCGAT
AGGTTCAAGAAAGTCATAGAGTACTTTAAGAGTTTGAGGAACTACTTGAAGTATTATGAA
ATATTTGAGGATGAGGGGAGCTAGGGAAATAGCAGTGGAGTCCTTCAGTTTGATTTGGGA
TTGTTTCTATAGAGTAATTTGATGTATCACTCAGGAATGATCTTCAGATTAGTGGTGCCA
ACTATTCAAGGAGAGATGGACCAGCTATCGGGAAGCAAAGGTGCAAAAAGATTTTTGCTT
TAAAAAGAGTAATTGAAAAAAGATTATACTTTTGGGAATAAACAAAACTAGCTCGCACCT
AGTTAAAGTAATCCTATCAAGAGTCGTTTGCCTATGGAAGCAATTTCAGGGCTAAGCGGT
AATTAAAATGCTAATAAAATCCCAATGAGCACTAAAAATTCAAATTTCATTCAGCAATGC
GAAACTTTGGCAATTGGAGGGAGGTATGATAATTTGATAGCAAATTATCAACCTATGGAG
ATACCTATAGCAGTGGGAGTTAGATTTTTATGCTGGAAGTTCATTATGAAAATGATCCAA
TAAGATAACCAAAGAAAAGATCAGACCTCTCTATATGCACCTCTAGATGTGTATATAGTA
TCGATAGGCGACATGACTTCTGAAAAATTGGAATTATAGAATGAACTGTGGAAAAATGGC
ATAAGAGCTGAAGCAAATTTAAGTAGCGATTTCCAGAAGAGTGACTAAATGAACTTATTC
GCAACTAGAAATCTCAAATTCCTTGTTACATTCAAGAAAGGTGTGTATGCAAATTCCAAA
AAAGTGAAGGTAAAAGATTTCGAGAATAAAGAGAAGGACGAACCAAGAGAGGGCCTGGTT
GAAAAGATTAAAAGCAGACTTAAGTATCACTATCAAAGTATGATGTGA


>Contig21094.0.g79(protein)
MPTQNQTNQQQQQIVEKQGTHKPLNSQKSEQITRKSKKKKAVVRNSHKQFSNEDSNNLIS
SSHSDPQHQSQLFQSQNKLQQKHDQNKSESQLMPSASIQSVTFSQALEKDNFDSKSMISV
SKRSQRSIFEINSQKSSKSQISQPSLIQQQSNASMDSSFEVRTNELEVLQSIYPDDIEII
EEISDQQKSPLQKSEKSLSQIPAQSKGKFKIRIYPHTVSENNFCWLDMLITYQDNYPHAM
PFISLQKATSKGLSELNFIEIESTIQLKSIEYLSDKEPFIFKLIVMVQDLLEGINQTTSS
YKRKQSKQSKERHQQHFQTDERLRENDSRNPDIVINSVTDNNETKHEKDLDEQQNPNEEE
YSYYDEEDEEQSSANQTQDKADSMQNTQEIIKNQIKQEEQLLREGMEGRQLEIQTPSFQR
VPSAFDNILNNLQHFQIDEDESLSYRAINQASQLLSLSHQSRYKQDFEELGKIGEGGAGR
VYKARHKFDRNIYAIKKVKLYKHDEEENDRIKREVTVISKLHNQHIVRYFQAWLEHIEDE
KEIKELAFSDSEVEEEDEKYENETDNSDMIDDSYYNSRKQRCKSQSDSDAVSRDEDDDEQ
DYYVEDDEDDEADYSESASCQSDSEIYISVSNKKGKKRGKKDKLDKKQYQFKKKVNYNKD
KLIKKKQQNIKRNLFKERQEQAKINQQKNPKYKGIQVLYIQMEFCEGNSLRNFIDENPGR
EQEEKKWKIFCQIVDALHYLHGLGLIHRDLKPSNIFLDKKYNVKLGDFGLATAHHHHHLT
AGNTMKHIQSPMQKNFTAKQQSKFNIYQQLNQQQQQSQKFNNAKQQLKLDLSSSQASTNF
QPDQPQLHLSFSNQAHSVGIGTPAYMAPEQEKGHGKYNFLTDMFSLGLIFFEMWIGFQTN
FEQMKAFSLVKNQSVIDKEYEKRIPENARKLIIWLTKENPKERPSTLQLLQSELMPQKLE
DEVFKKFAYSISNQKTIESIQLMNFLLKRKTPKNIDLTFESYIFDQAMQQQSGIGLNGYN
GYGLNATSSHGNQGGYFGQLNIGQTLSRGIQPQTSQLGFRQDMKLHLSDRIQKESIAKSM
LKNSFKQVFVMHGAMDIDIPILAPVMDQATIFVSLRQQRFSLDRRMSHNSEGSGPENLGG
TEDQLHNIEVDVPTGLVKFSEQTASGTSVNHTTPNGIITSGTNKQLLMYLKERDIQKVTY
LSIDPQFNVQKILDDSGYVLQLQNNLTTNFARFIARKQLPFFKRFHIGKIFKKNQQFQRT
TPEEHLEASFDITSLMSGSHYTSGDEIIYEAEVIKVADQIAQSFSGILGRGYKIKVSSSE
IIDGIMEECHISISRRHLLIRDLSMNLDKEPWGNIKKRLIKNDLINQANAERLGEFLKIR
GSIAQIEQQIKNNRSMRQVDRFKKVIEYFKSLRNYLKYYEIFEDEGSQGNSSGVLQFDLG
LFLQSNLMYHSGMIFRLVVPTIQGEMDQLSGSKGAKRFLLQKEQLKKDYTFGNKQNQLAP
SQSNPIKSRLPMEAISGLSGNQNANKIPMSTKNSNFIQQCETLAIGGRYDNLIANYQPME
IPIAVGVRFLCWKFIMKMIQQDNQRKDQTSLYAPLDVYIVSIGDMTSEKLELQNELWKNG
IRAEANLSSDFQKSDQMNLFATRNLKFLVTFKKGVYANSKKVKVKDFENKEKDEPREGLV
EKIKSRLKYHYQSMM