Identifiers and Description

Gene Model Identifier

Contig13568.0.0.g3

Standard Name

EIF2AK1b

Aliases

Contig13568_0_0_g3

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000525409.000751454575209e-33Protein kinase domain containi
ng protein
SGDYDR283C9.997975313387782e-28GCN2 SGDID:S000002691, Chr IV
from 1030049-1025070, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13568.0.0.g3(coding)
ATGAGAAGCCCATCTGCTGCTTTTTAATTCAACCTAATCGAGCAAAAAAGGAAAATGTCT
AGATTTACAATAACTTTAGTTATTAGTTTAACTCTAGCATAGTAAGTCATGCTCGTTCCT
GCATCCTCCCACTCAAACTAAATTCAAGGGGGTGTGCATGAAGTAGTAAAGCATGGATTA
GAATTTAACGGGTATTTAAATGATCAGGTTTAAGAGGGGTAGATGAGCTCTTAAAGTTTC
CAAAAAATGAAATAGAAAGACTAACATTTAGCAAAGACCTCCTCAGATATTAAGAATAGC
TATGAAACATTCAAACTCTCTTCGTTATAAAATTTTCATGATAACAAGATGAATTTTGAG
GCTAAAGTTGAAAACCGAAAACCCACTACAATGCTATTAAATTAAGACTTAAAATATAAC
TTTAACACGGAAGGTGCCTCCTCTGATATTATCTAAAATATTTCAGAAGATGATTATACT
AAATTACTTGTAGACTATTCAGATTCCTATACTATCGCTTATGAAGATAATACAGACTAC
GGATTCTAACACAAAACTAATGACTAGTAAACTCATGAATCACTTAACCTATAAGTTAAT
GAATTCAAATTCAATATAGTAAACCACCAAGATGATGTTCTATAATCAAGCAACTAAAAC
GAAGATCAAAACCTCCATTTTTAACTATAAAAATAACTAGATAGTTTGAATTTTCAACCT
AAGAATGCTTTCCATACAACTGATTCTCATTATAAAGAAGAAATTTAAGATTGTCAGAGT
GAGAATGTGGTTTAAAGGGGAAATCTTTAAAGTTTAAAGGAAGAAGAAAATTGCTAGAAA
ATTCAGAAAAATCCAGATAATTCAATTTCTATAATATAGCAATCTCAATAAGATGTGACT
CTTAGTGAGGAATCTTCATCTAAGCAAACCGCAGTTGCCTAAAATAATTTGAATTTATTA
GAAAATAATAATATTAACAACTAGGAAAAATCCAAAATTGGCTTAAAATAAAATATCTTA
GAATTATAATAAGATAGTGATTTAATGCAATCTTTTTAAAAATATCCAACTTATACCCAT
TCAAGTGGATAATAAAAAATCGATAGCTAACTCAATTAAATGAATCAGCACCAAGAGCAA
TTCCTGGAACCTACTTAATGTGAATTACAATAAAATCAGTGTACAACTAATAAGAAGTCT
CTCCACGAGTAGAACTTTAATTAAATTCTTAACTCAAAAAGAAAGTTTTCGGAAATTTCT
GATCTTCTTGAAAAATAATAAAATTGGATATCGCCCTCAAATTTATAAGGACAGTTATTA
TGCTCATAAAATATCCAAAATTAAGCTGATACTAATTTAGAATAGAAGGCTTCTAAGTTA
TAAATATAAAACTTGGACTGCAAAAATGGAGTATAATATTCATAAATTACTTGTCAAGTA
AACGAAATGAATTATTTTGAATTGAAAATTAGAGAAAATCCCTTATATGGGATAGTGGAA
TAGTAAATCCCTAATTGCGATGTCAATATCGAGAATATATAGTAAAACTCCAATTAAATT
GATAATAAATAAAACTATTAATCATAATAGTAAGAGGGAATTAATAGATCAAGTCATATG
TAAATCTATAAAGAAAGTGCTTAGGACTAAGACATTGTTGATAGCAGGCTTGTGCAACCA
GTTAGTTGTGGCTTCAATTGTAAAGAATCAGAAACTATTTAAATGAAAAATCAAACTTAG
AAAGTCTTTGACGTAAGGGATAACAAAAAGCTCCTTAAAATTTTGAATATACAAGACGAT
AGAGATCAAGAAAGTCTTGTGGGTCACGGCACTCTTTCTAGTATTTCATCAACGTACATA
TAAATCACTCTCTCAGTTGCCATTATCTTCGGCTTATTGTTCTTGATAGCCTGCATAAGC
ATCCTCTCCTATAAAAAGTACAAGTCTCTTATGGATAAATTTTCTGATTTGGAGCGAAGA
AACTAAGAGCTGTAAACTTAGAACTAGTAGCTAAGTAGTGTATAGAGATAGAGTAGTCAA
CAGCAACAATTACTCAACCCATTAGCTTAAAATATGGACATGAACCTGTAACTATAGAAT
ATTGCGAGATCATAGAGCTAGAGATAATACAACGAGAAGGCTCCCTATGAGTTTAGTAGT
CATGAGACCTTTGAAGAATTCAATTTAGAAGAAAAGACTAGAAGAAGCCCATCTTTGGAT
TATTCTGAATCTTAAAAAAGCAAAGAATTCAAATCTTGCTAAGAGAGTCCTACTGATAAT
CAACTTATAACACCTCACAGAAGAGATTTTTCTGATCCCTCAATTTAAAACTTAACCTCA
ACCCCAAAGAACAGAAACAACCAAGGACATATTTTGAATGCTGAGCTCTCCCCTTATACG
ATACCATTTCATAATGAACGTATTGAGAAAGTAGTAAATTACGAAGATAACTTAAGCTAA
AATTAAAGTACATAACAAATGTAACACAATTTCAAAACTCCCACTAGACATGAATCTGAA
CCATAGATTCCTTAACTAATGAAATCAAAATGCTCATAACCTATAAATGAGGAAGATTTT
GTACTTTAAGACAGCTAGGATCTTAAAAACTACTGCCTAAATGAGAATAATTCACTTAAT
TAAAATTATCTAACTAATCATCATCTCAATAGAAGTCCAATTTTTGTTTCTGATGAGACT
GCTGAATTGAATATTAAGATCTAAAATAAAGGAGAGACAGTTAGCTGTCAGAAATTCTTA
TTCAAAGATTAATCTTAATATTAGGGAATCAATGAAAAGCTACCTCTAATTAAAAACACA
AACATACCTCATTTAGATTTAGGAAAACTATATGCATCCTAAAATATTTAAAAAGAAGAG
TAAAAGTAACTCTTTCAGATAAATATGAACCCAAACAACATAAGATTCTAGTAAAGGTTA
TCTGAGGATCAATAAGACTACTAATCTAAATACTTTATAGATAATTTTTCATTCAATAGG
CCTATTCAAACCGAGAGGGGATCTAGCTAAAATTTAAGGCCACTACAGTTATAGAAGCAC
CCTAGCTATATCTAGTAGCAGAAGTAACCATAGTTTAATAACTCCTTATTCAAAAATCAG
AGAGTGAAGTAATTAGAATAAGTTCAATTTTAATAGAGATAAGATAGAAATATACTTTGT
AACCAAGTTAAGCAGAAAACACTTTCTCTAGGAAGAAACGCTTTTTAACAAAACCAAACG
CAAGCTCCATTAGTTCAGAGAAATATTAGCTTTAATCATAAATCAAACATCTCAAGTATT
TCAAGGCTAAATAAGAAGTAGTTACAGATCAATTTGAATACCTAAAACAACAAGCATATT
GCTTCACCTTAATTATTCCCAATATAAGTAGATTAAAGATCCAGAGGGTCCTTTAACTCA
AAGAGCGGCCGTTTAGCTTTATAGTCAAAATCAATAAATAACTTCCAGTTAAGTAACTAG
CTACATCTATGCTCTAATCAAGATACACAAATTTAAAATATTGCAGATCAAGATCATTAA
TCAATTGATAGTGGACAACTTCATCTGCAATAGACTCACTAAGCTTACAACATGAGCTAA
ATGTCAATTGAAGACTACCAGCTAAACTAATTGCAGTAAAGTTTTGAGGGCAATTTGAGG
TCACCTATGACTACGTTTCCTTAAAATCCTCCTCTTATTTCTAATGAACAAATGCTATTA
AGAAATCAGTAATCTGCCTCACCTAAATGCCAATAACAAATGATTGGTGTTGATAAGATT
TTCATTGAAGATCAATTATACTTGCAAAACAGTAACAGTTTCGAACATGATAATGACGCA
CTTAATCACGCTCACAGACCAATAAACTTCAAGCTAAATTACACTGGTTCATTCTTAAGT
GAAAGACATCAGACTGAAGAGGACATTATTTGCAACGACTAATACTAATCCTTGCTCTAT
TTAGAGAATGGTCGTTACAAAAACTCATTTTTGGAATAGAAATTCTTGGGTAAGGGAGGC
TTTGGGATCTGTTACAAGGTATAACACAGAATTGACTCAAACTTCTATGCTATTAAGAAA
ATCAGAATGCATCTCGCTTCAAATCAAGAAATCAAGGACCACAAAGTCTATAGAGAAATC
ATGGCTTTGCCTAAACTTAATCATAAAAATGTTGTGAGATATTTCGGTTGTTGGGCTGAG
AAAATTGATCACGAGCAAGAAATCAAGATTCAAAAGAGAGTCAGAGAAATTCAAAAAATG
ATACAGGAAAGAAAAAACAAGTATAAGAAGATGAATGGTACTAAGAAGCCTCATCTTAAA
AAGCAACTTTAAGCAAAAAAACCTAAAATAAGTGCGAAGAAACTTGCTGACCAAGATAAC
GAAGAGTACTTCAATGTTAACGATTTTGATGTTGAGAGAGATTTGGATGAAATTTTTGAT
AAATAGGAAGATTGTGATTCTATACCCTCTTCACCATTAAGAAAGAGTGAGAGGAGTCTA
TAAGAAGAGGATTCCCACAGTTCTTATTATGAAAGAGATTCGGATGATTCAGAAGAGGAA
CAAAGTCAAGTCAACGATGACGAGAGTTACGAAGTTGACAAAAGCTAGGATGAAGATCTA
TCAGAAAAAGAAGACAATCTTGAAAATGATTCTAATCATTCCTCTCTAGGTTCAGAATTC
TCAAACTCCTCAAACAAAGATAGCTCAGATTACGCAGATGAGGAAGAGGATCAAGTGTCA
GATATTGAACCTGATATTTTTGGGGAAGACGATATCATGAACTAATCAAATCAAGATGTG
GAAGACAGCACTGGAAAGGTTGGAATATTCGATGATGAAGCTCTATTTGAGTTTATTAGA
AAAGAGCAATAGTTTGTATCCATAGATCTTATGATACAAATGGAATACTGCTCAGGTGAT
AGTCTATAAGACAAACTTTCACAAGATGATAGAAAAATAGACAGACTTCAAAATCTCTAG
TACTTCAAGCAAATGCTTAACGCAGTCAAACACATTCATAAGAACGGTTTTATTCACAGA
GACCTTAAACCAGCAAACGTTTTTATTGAGGGGCAACTACTTAAAGTAGGTGATTTTGGA
TTGGCCAGAAGATTCAATATGCATCTGCCTTAGTTAGATATCATTGAGTAAGCTATAAAC
AGTGCTAATTTAAAGTCTCCAAAGGGCTTCAAAAATATCAGTCATAAGGGCTTAAGAAAG
TTAGTTAGGTCTATTTCTTAGTAGTCTTTACTTACCTCTAATGTAGGGACAAGCACTTAT
TTAAGTCCAGAGCAAGAATCAAATAAGCCATACAATGAAAAAGTAGATATTTATGCTTTA
GGACTAATTCTTTGCGAATTATGCTGTATATTCTCAACTGAACATGAAAGAATTTAAACT
CTAAATGATCTGAAGAGACATGGAAAACTAGCAAACAAAATAAAGAAGAATTTCCCATAA
GAATCATAAATTATGCTACTTATGGTAAATAAGAATCCAGAGTTTCGACCTAGTGCTGAA
GAATTATGCAAGAACGAACTTATGACTGAATGGGAAGCTTCTTTGAATCAACCACTCAAT
TTATCTTCAGAACAAAGACCTTCAGAGAGCTAGCTCTAATTGAAATACGAAACTTGCAAA
AATATTCCCTTAGATAGACACATTTTGGAAAATCCAAGTAGCGAGGACAACCAAAAAATC
TTAAAGAATGTAAGTTTGAACATGATAACTGAAGAACAGACAGACAAGTCCCAGTATATA
ACCTCTAAAAACAATGAAAGTTTGAATAACAGCTTCAAAATGGACTCATTCACTAGAATT
GGTGTGAAAATTAACAAGAAAATGCAAAAGGTGAGCTCAGTGTAAAACTATGCCAAATTA
CTCAGATTAGAATCATCTTGCCTTTATAATGAGAATGAAAATATTATGAATGCGCTATAA
AACCCTCATAATAAAGAAGAGGACGATCAAAAGAATAATAGCAAAATATCTGATATGGAC
TAGAATTCTCAATGA


>Contig13568.0.0.g3(protein)
MRSPSAAFQFNLIEQKRKMSRFTITLVISLTLAQQVMLVPASSHSNQIQGGVHEVVKHGL
EFNGYLNDQVQEGQMSSQSFQKMKQKDQHLAKTSSDIKNSYETFKLSSLQNFHDNKMNFE
AKVENRKPTTMLLNQDLKYNFNTEGASSDIIQNISEDDYTKLLVDYSDSYTIAYEDNTDY
GFQHKTNDQQTHESLNLQVNEFKFNIVNHQDDVLQSSNQNEDQNLHFQLQKQLDSLNFQP
KNAFHTTDSHYKEEIQDCQSENVVQRGNLQSLKEEENCQKIQKNPDNSISIIQQSQQDVT
LSEESSSKQTAVAQNNLNLLENNNINNQEKSKIGLKQNILELQQDSDLMQSFQKYPTYTH
SSGQQKIDSQLNQMNQHQEQFLEPTQCELQQNQCTTNKKSLHEQNFNQILNSKRKFSEIS
DLLEKQQNWISPSNLQGQLLCSQNIQNQADTNLEQKASKLQIQNLDCKNGVQYSQITCQV
NEMNYFELKIRENPLYGIVEQQIPNCDVNIENIQQNSNQIDNKQNYQSQQQEGINRSSHM
QIYKESAQDQDIVDSRLVQPVSCGFNCKESETIQMKNQTQKVFDVRDNKKLLKILNIQDD
RDQESLVGHGTLSSISSTYIQITLSVAIIFGLLFLIACISILSYKKYKSLMDKFSDLERR
NQELQTQNQQLSSVQRQSSQQQQLLNPLAQNMDMNLQLQNIARSQSQRQYNEKAPYEFSS
HETFEEFNLEEKTRRSPSLDYSESQKSKEFKSCQESPTDNQLITPHRRDFSDPSIQNLTS
TPKNRNNQGHILNAELSPYTIPFHNERIEKVVNYEDNLSQNQSTQQMQHNFKTPTRHESE
PQIPQLMKSKCSQPINEEDFVLQDSQDLKNYCLNENNSLNQNYLTNHHLNRSPIFVSDET
AELNIKIQNKGETVSCQKFLFKDQSQYQGINEKLPLIKNTNIPHLDLGKLYASQNIQKEE
QKQLFQINMNPNNIRFQQRLSEDQQDYQSKYFIDNFSFNRPIQTERGSSQNLRPLQLQKH
PSYIQQQKQPQFNNSLFKNQRVKQLEQVQFQQRQDRNILCNQVKQKTLSLGRNAFQQNQT
QAPLVQRNISFNHKSNISSISRLNKKQLQINLNTQNNKHIASPQLFPIQVDQRSRGSFNS
KSGRLALQSKSINNFQLSNQLHLCSNQDTQIQNIADQDHQSIDSGQLHLQQTHQAYNMSQ
MSIEDYQLNQLQQSFEGNLRSPMTTFPQNPPLISNEQMLLRNQQSASPKCQQQMIGVDKI
FIEDQLYLQNSNSFEHDNDALNHAHRPINFKLNYTGSFLSERHQTEEDIICNDQYQSLLY
LENGRYKNSFLEQKFLGKGGFGICYKVQHRIDSNFYAIKKIRMHLASNQEIKDHKVYREI
MALPKLNHKNVVRYFGCWAEKIDHEQEIKIQKRVREIQKMIQERKNKYKKMNGTKKPHLK
KQLQAKKPKISAKKLADQDNEEYFNVNDFDVERDLDEIFDKQEDCDSIPSSPLRKSERSL
QEEDSHSSYYERDSDDSEEEQSQVNDDESYEVDKSQDEDLSEKEDNLENDSNHSSLGSEF
SNSSNKDSSDYADEEEDQVSDIEPDIFGEDDIMNQSNQDVEDSTGKVGIFDDEALFEFIR
KEQQFVSIDLMIQMEYCSGDSLQDKLSQDDRKIDRLQNLQYFKQMLNAVKHIHKNGFIHR
DLKPANVFIEGQLLKVGDFGLARRFNMHLPQLDIIEQAINSANLKSPKGFKNISHKGLRK
LVRSISQQSLLTSNVGTSTYLSPEQESNKPYNEKVDIYALGLILCELCCIFSTEHERIQT
LNDLKRHGKLANKIKKNFPQESQIMLLMVNKNPEFRPSAEELCKNELMTEWEASLNQPLN
LSSEQRPSESQLQLKYETCKNIPLDRHILENPSSEDNQKILKNVSLNMITEEQTDKSQYI
TSKNNESLNNSFKMDSFTRIGVKINKKMQKVSSVQNYAKLLRLESSCLYNENENIMNALQ
NPHNKEEDDQKNNSKISDMDQNSQ