Identifiers and Description

Gene Model Identifier

Contig9429.0.g37

Standard Name

EIF2AK1a

Aliases

Contig9429_0_g37

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000525401.0000099287337047e-53Protein kinase domain containi
ng protein
SGDYGL179C0.000000000000004001928599951003TOS3 SGDID:S000003147, Chr VII
from 165091-163409, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9429.0.g37(coding)
ATGAAAAAGACACGATCTAGCATATACTTTTCTGGATTTTTCCTAACTCTGGCCGTGCTC
CTGTGCGCCCTCCTCCTTTCCTAACAGACTCAATAAATTATGGAGACCCAAGGATAAAAC
GTGGAAATTGCAAAGGATTATCAGATTTGCACAGAAAGTACGGAAAAGTGCGAAAAAGCA
GCTAGTTAGATTACAGTTTAAGAAATATAAGATCATCTTCACAGATTAACTGTTCCGATC
GAACCTATTCTCGTTACGGAAACACAGATTGATCGTTAAACCTAGGATTACTAACTTATA
CATATTGAATAATAAATTAAGGAAGCCAAGAATAGTGAAAATAGAATTGATTCTGGAGCT
CCTACAATTAAGCATAATAGTTAAGAGGAAAAATTTAATAGTATAAACTCAAATTTGAAA
ATATCCTCAAGCAAATAATTATAAATCAGCCCATAACTTAATAAATAAATTGCCACCATT
GAGAGAATTAATCATTCTACAGAGCAGATCATTGAAAGCTAAACAACAGCTATAGTTTCT
TATAATAATATCGAGAGCCTTAAGTCCACACATGTGTCAATAAGCACCTTCGACTAGAAC
ATTCTAGATGTTTAAGTCAATAATAAAGATAAATTAGTGGTCCAGAACTAAGAGATATCT
ATCTCACTTGAAGAACTGGTCAGGAACTCAATCGTCACTTTGCCATAGGAGCTCCCTAAC
GTTTTACTCAGTAGTACCATGACTACACAGGTTTATGTTTTGGATTTCGATGACTTGTAA
CAAACTTCATAATTAATTATTGATGAAAGTTCCTCAAAGTCTTGCAATAAAGACTTGGAC
AATTTCGATATCTTAGATATCTCAAAAGAAAGTGAATTGCCAGCGACCTTTCGACTAAAA
GATGGGTCTAATAAATACTCTTGGGGTAACATGCACTCTAACATTTACTCTTAAGAAGGA
AATGAATGCCCTAAAGAAGACCAGAAGTTTGAAAATAACATTGAATTTTAGGAACACTCT
CACAGCACAATCGTCACTAGAGTTGATTACCATCTCACAGCCATAGATCAACAGTCTGGT
CAGATTTTATTCAATGTCACTAAATCAAATTTTATGCCACACTTTAATCAAGTTACAAAG
CAAAAATTCGTCAGCTATTAAGACTTTGTGAAGAATTAAGAGACTCCAAATATCAGCTAA
AATAGACTTAATGTTAAAACTTTCAATCATATGTCCAAAACTTAAGAAAAGACAAAGGAT
GGAAAATTAGTTTGGTATAACAATATAAATCTCTCTGACGAAATTGAGAGTTAAAGAATC
AGCTTTATCGATGATCTTTAAAGCCTTCATTAATCAGACCTACTCTCCCCCCTAAACCCC
TAAACCTCTGCTCAGAACAAAAGTTTGTTACACATCGTGAAGGAAAACCTCAACAAGAAT
GACGACAGCACTTTGTATATCTTGGCTGCAGTAATTATCCTTGTGGGAATAGTTGTGGCC
CAGTTTATTTACATAAGAAGGATGAAAAGAAAGTAATTGTAAAACGAGGAAAATACCAAG
TAGCTTTAGTAACAAATTGAAATTGAACATAATTACAGACATAGCTAGACTCAACAAATT
ACAGTAGAGTAGATGGATTTAGCTTCTGTATCTGATTATACTCCATAGCATAAATCTCTC
GGTTAGCGTGATAACAAGAGTAAATCCTTATTTATCTAATCACAATTGAAATCAGATAGT
GATGATGAGCCTTTTGTCTTAAATCAAAGAGAAAGAGTACAGTCAAATAATCTAAATGAT
AATACATCTAATTTAATAGCTCTGATCTAACAAGTAAGAAGATAGAGTGAAGAGACCTTC
CCCAACAAAGGAGAGAAACTTATGAACAACCTAGGTTCATCATAATTGAATCAGAAAGAT
AGCGAAGATTAATCAGTAAAATCAAACTCTAAGTCTATCGATCATGATTTTTTCCATGAA
TACTCTTCTAATCATTAGAGCCACAGTGAGCAACATACAATTGAATAAGAAAACCAAATT
CAATTATATAATCCAAGTTTAGTGGCCCAAATAAACAGTCCATAAGCTTTGCCTGAAAAA
ACTGAAATATAGAATTAGCTTAAATTTAGAAGGGAGGAAGGGAAAATTGTAAGAGAAGAG
ATCAAGAAAGTTACAAAAATTTATGATGACACTCCAGAGATCAGGGATTAAATTTAGACA
GAGATTGTTGAAATGTAAAGATAAATTAGTGGTGCCTAACATGCAATAGACTGCCAAGGA
TACGACGTATGTCCAAATCCTTCATAAATTGCATCTAATCTTTTTAGCAACAATTATAAC
AAATCTAATAAAGATAGCGGTTCTAATTTTGACAAAGCAAGTTTCACTGATTTTAAAGAC
CAATCTTTGACTTCATAAGATCTTAGTAAAGCAAAGGAAATAGAGAAGGATGATGTATAA
GAAATCATCTTTGAGTCAAATTAAGTTATTGATAGACATTTAGATTCACAACCAAAGCAA
GAATTGAAAGTGTCTTTCATTAAAAGATAGTCCGATCAGGAAAAACAAATCCAACTTTAA
AAGTTTCAATCTTCTTAGGTCTCCTTAAGATAGGTTATAAGGTCTTAGAATTCCTTCAAA
GCTCTCCCACCTACTTAAATTTTGCACTAGACTAAAGCATTAATAGAGAAATACCTCGAA
AATGGTAGGTACAGGAAATAGTTTGAGACTATCAGAGAGCTTGGAAGAGGAGGATTCGGA
GTGGTCTACTAATGCAAATATTCCTTAGATGATAACATCTATGCTATCAAGAAGATTAAA
CTTCACTTGGGAATAGCTGAAACTCTTCAAAATCACAAGGTTTACAGAGAGATTCAAGCA
ATTACTAAGTTAGAGCCTAAAAACATTATAAGGTATTACACTTGCTGGATAGAGGGACTT
GACGATGAAGAATAGCTACAGGAAATGAAGTTTGTTAATCACGTTAAAAAGCATCATAAT
TAAAATAAAAAAGAAGGCAATAAAAAGTTAAAGCACCAAGACAGTGCTCTATCTTTAAGA
TCAACAAACGATAAATCCTAGATAGATAGTTTAAGAAAGAAAAGAGCAAAGAAGGGTAAA
TTGAGCAAGCAAGAGAGCTTAATTTTCAATAACAACTCAATTGACTCAGCTGCATTCGAT
GATAACGATGATGAAATTTCTGAGGAGTATGAGGACGATGATTATTATCAAGATGATGAT
CAAAGCATAGATTACGATAATAGTTAGGTGGACGATAGTTCAATTTAAGACTCAGAAGTA
AATGATATAGTCTCACATCGAGATCAATTATCAAGAGCTTAAATTGATCAAAGCCACTAT
ATCGGTGGTTCACTATCAATGTATACCTTATAAGAACTTGTTAAATAGGACAAGCCATTT
ATTTCTCTCAATCTTATGATTCAAACAGAATACTGTTCTGGTTAAACTTTAAAAGACTTC
ATAGAAAATAGAGGACCATAAATTGACAGAGAATATAACTACCGTATCTTTTCACAAATA
GTGAATGGAGTGATGACAATTCACGATGCAAACATCATTCATAGAGATCTAAAGCCAGAA
AACATCTTTTTGGATGAACATAATACAGTTAAGATTGGAGATTTTGGCTTAGCAAGAGCA
TTTGACGATGCCTTTATTATTCCATAAACATCGACAACTTAAAGAACGTCTAAAAGAGAA
AATCATGAATCTGCCAACGAATCTGGGGCTGTAGGGACGCCCTTGTATTTCAGCCCAGAA
CTCACTTAACAACTTAAAAACAGAAACTTTAAAATTAACTATGCTGAATTAGGAGAGAAA
GTCGATATATATTCTTTAGGTCTCATCCTTTTGGAATTATCTTCAAACATGAGTGTCACT
TATCATGAAAAAATGACAATGTTCAGTATGGTTAAAGACTAAAGAAAACTGCCTCCTAAG
AGTAAGCTGACTGGAACTGTTGAAGGGGAAATTATTCTGGCACTTACTTAGATAAACCCA
GAATCAAGACCTAAAGTTCATGATGTAAGAGATTTGCTCCTCCCAAAATGGAGAGAAAAT
CTTGATAAAGCTAGATGA


>Contig9429.0.g37(protein)
MKKTRSSIYFSGFFLTLAVLLCALLLSQQTQQIMETQGQNVEIAKDYQICTESTEKCEKA
ASQITVQEIQDHLHRLTVPIEPILVTETQIDRQTQDYQLIHIEQQIKEAKNSENRIDSGA
PTIKHNSQEEKFNSINSNLKISSSKQLQISPQLNKQIATIERINHSTEQIIESQTTAIVS
YNNIESLKSTHVSISTFDQNILDVQVNNKDKLVVQNQEISISLEELVRNSIVTLPQELPN
VLLSSTMTTQVYVLDFDDLQQTSQLIIDESSSKSCNKDLDNFDILDISKESELPATFRLK
DGSNKYSWGNMHSNIYSQEGNECPKEDQKFENNIEFQEHSHSTIVTRVDYHLTAIDQQSG
QILFNVTKSNFMPHFNQVTKQKFVSYQDFVKNQETPNISQNRLNVKTFNHMSKTQEKTKD
GKLVWYNNINLSDEIESQRISFIDDLQSLHQSDLLSPLNPQTSAQNKSLLHIVKENLNKN
DDSTLYILAAVIILVGIVVAQFIYIRRMKRKQLQNEENTKQLQQQIEIEHNYRHSQTQQI
TVEQMDLASVSDYTPQHKSLGQRDNKSKSLFIQSQLKSDSDDEPFVLNQRERVQSNNLND
NTSNLIALIQQVRRQSEETFPNKGEKLMNNLGSSQLNQKDSEDQSVKSNSKSIDHDFFHE
YSSNHQSHSEQHTIEQENQIQLYNPSLVAQINSPQALPEKTEIQNQLKFRREEGKIVREE
IKKVTKIYDDTPEIRDQIQTEIVEMQRQISGAQHAIDCQGYDVCPNPSQIASNLFSNNYN
KSNKDSGSNFDKASFTDFKDQSLTSQDLSKAKEIEKDDVQEIIFESNQVIDRHLDSQPKQ
ELKVSFIKRQSDQEKQIQLQKFQSSQVSLRQVIRSQNSFKALPPTQILHQTKALIEKYLE
NGRYRKQFETIRELGRGGFGVVYQCKYSLDDNIYAIKKIKLHLGIAETLQNHKVYREIQA
ITKLEPKNIIRYYTCWIEGLDDEEQLQEMKFVNHVKKHHNQNKKEGNKKLKHQDSALSLR
STNDKSQIDSLRKKRAKKGKLSKQESLIFNNNSIDSAAFDDNDDEISEEYEDDDYYQDDD
QSIDYDNSQVDDSSIQDSEVNDIVSHRDQLSRAQIDQSHYIGGSLSMYTLQELVKQDKPF
ISLNLMIQTEYCSGQTLKDFIENRGPQIDREYNYRIFSQIVNGVMTIHDANIIHRDLKPE
NIFLDEHNTVKIGDFGLARAFDDAFIIPQTSTTQRTSKRENHESANESGAVGTPLYFSPE
LTQQLKNRNFKINYAELGEKVDIYSLGLILLELSSNMSVTYHEKMTMFSMVKDQRKLPPK
SKLTGTVEGEIILALTQINPESRPKVHDVRDLLLPKWRENLDKAR