Identifiers and Description

Gene Model Identifier

Contig1669.0.g92

Standard Name

EIF2A

Aliases

Contig1669_0_g92

Description

Eukaryotic translation initiation factor eIF2A

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam08662 ) Eukaryotic translation initiation factor eIF2A
  • ( pfam04725 ) Photosystem II 10 kDa polypeptide PsbR

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002947902.000364041471746e-45hypothetical protein
SGDYGR054W6.002718307283067e-26YGR054W SGDID:S000003286, Chr
VII from 596693-598621, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1669.0.g92(coding)
ATGGAGGGAGGAAGCATTTACGCAGCATTTGGAATGCAATAACCACAGCAGCAATAGACC
TATTAAGAAGAGTCGAAAGTTTCAGTAAACTACTAAGGTGAGTAGAGACTCTTGATTCTT
TCAAGTAAGGGCGCTCAGTTCTTCAAAATGACACCTGGGTCAACTCCTACCGAGTCATAA
TTAGCTCTTGACAAAAACTTCCCATAGTATGCCACCTCAATCACAGGCAGGTTTGCGCCG
CATAAGGGTCACTTTGCCGTGATTGTGGATTAGATGGGTATACATTTCGTGGATACTAGA
ACTGGAAGAGAGTCAAGATTTATTGATCACTACGGAGTGACCGCAATTTCGATCTCACCT
AGGGACACCTATCTAATAACTTGTGAAAAGTACAGTCCAGGAAAGAATAATTTGATTTTA
TGGCATACTGGATCTGGCACAGAGTCAGCCATGTTTGAATGGAAAAAATAATCAAAAGAG
GGCCCAAAAAGCATAAAGTTCTCTTTAGATGAAAAGTACTGTGCCAGACTATCATCCAAA
ACTACGATTGACTTATTTGAGGATGGAAACTTTTAAAACCCTAGAGCTACAATCACAGCT
AATGCTTCAACTCTAGGAAAGTAAGGAGAAAAGAAACCTTACTGGTTTGATGGAGTAGAT
TTCATTCCAATGTAAAAGGATAGTGGAAATGGATAAACAAAACCACATTTCATGATAGCA
TGGTAAAACTCTGAGGGCCTTAGCGAGAATATTAATGAGGTAGGAGGAAATGTATATTTC
TTCGATTTGAACTCAGCTATAAATAAGCCTAAGTTTGCAGTTCAATGCAGCAAAGCTTAG
GAAATTCATGTAAAATCATCACCTACAGGAGAAGCAGTCCTTATCTGGTCATAAAACTAC
GTTGATTCAACAGGTAAAAGTTATTATGGTGAGCATTGCTTACAATACGTGCAGTTAGTT
GGAGGAAAAGCTAGAGTTTTCGTACCAGTATTTGATGGGATGATTCATGATGTAAAATGG
TCTGCTTTAGGAGACTATTTTATTGTGATTTCTGGAACTCAACCAGCAGTTGCCACTCTT
TATGACAAATTAAGTAACCCAAAGTTTGAGTTTGGAAAGAGATACAGAAACACAATCAGA
ATTGATCCATTTTCTAACGCAGCCATTATTGGAGGTTTTGGTAATTTGAAAGGAGAAATT
GATATTTGGAACTTGGACAGACATGCAGAATATGGTCAAACAAAATCCTATTGTGCAGTA
GGTATCGAATGGGCACCAAATGGTATTCATTTCATGACAGCTGTACTCTATGAGAGAGTC
AAAGTTGACAATGAAGTGAAAATATTCCTAGCTAACGGATAGCAAGTGCATTCACTAGAC
TTCAAAAAAGATGAACTGAATGAAGTATATTGGTAGCCATTTGAACAAGGAGTTTTGTAA
AAACCAAATCTAGCAACTTTAGGAAAAATCAAAGAAATCAAGAAAGAAGATGCCAAACCT
AAGAGACTTTGGGGTTAACCAGGCGGAAGCAGTGTATTCTCCTAGATAATGAGACAAGAA
ATGTCAAAAACAAACGAGAAGGGTCCTAAATAAGTAGACAAAGCTTAGTATAAGAACTTG
ATGAACGAGTAAGCTCAACAACATGCAGATTTTATAGCAAATAGCAAAAACGACACCTAT
AATCCCTCCTAAGATTCCCCAGTAGCAAGAGAAGCTTGGCGCAAAAATTTCGGAAGCAAA
GAGCCTTATGAACAAGTTCAATAGCTCTCTTCCTAAATGGAAAATGACTTTGCAATTGAA
GAACAAAAGCTGAGCAAGCACGCAAAGAGAAGAGCCAAGAAGAAGTAGAAGATTGTAGTT
TGCGAAGGGAATCAGTAAGATTAACAGCAATAGCAAGAAGACCAATGA


>Contig1669.0.g92(protein)
MEGGSIYAAFGMQQPQQQQTYQEESKVSVNYQGEQRLLILSSKGAQFFKMTPGSTPTESQ
LALDKNFPQYATSITGRFAPHKGHFAVIVDQMGIHFVDTRTGRESRFIDHYGVTAISISP
RDTYLITCEKYSPGKNNLILWHTGSGTESAMFEWKKQSKEGPKSIKFSLDEKYCARLSSK
TTIDLFEDGNFQNPRATITANASTLGKQGEKKPYWFDGVDFIPMQKDSGNGQTKPHFMIA
WQNSEGLSENINEVGGNVYFFDLNSAINKPKFAVQCSKAQEIHVKSSPTGEAVLIWSQNY
VDSTGKSYYGEHCLQYVQLVGGKARVFVPVFDGMIHDVKWSALGDYFIVISGTQPAVATL
YDKLSNPKFEFGKRYRNTIRIDPFSNAAIIGGFGNLKGEIDIWNLDRHAEYGQTKSYCAV
GIEWAPNGIHFMTAVLYERVKVDNEVKIFLANGQQVHSLDFKKDELNEVYWQPFEQGVLQ
KPNLATLGKIKEIKKEDAKPKRLWGQPGGSSVFSQIMRQEMSKTNEKGPKQVDKAQYKNL
MNEQAQQHADFIANSKNDTYNPSQDSPVAREAWRKNFGSKEPYEQVQQLSSQMENDFAIE
EQKLSKHAKRRAKKKQKIVVCEGNQQDQQQQQEDQ