Identifiers and Description

Gene Model Identifier

Contig4801.0.g31

Standard Name

EIF1B

Aliases

Contig4801_0_g31

Description

Translation initiation factor SUI1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005389101.999790113608142e-24Translation initiation factor
SUI1 family pro...
SGDYNL244C1.0004572433669413e-23SUI1 SGDID:S000005188, Chr XIV
from 187496-187170, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4801.0.g31(coding)
ATGTCAGAAGACCAGTCAAAGAAACTCAAGAAGGGAACTAAGAAGCCAACTAAGGCTGAG
GAAAATGAGACCAGAGGAGGTGGTATGGAAATCATTAATTTCGGTGGAGATAACGTCGAT
GAAGATTTCGAGAAGCAAAGAGAACACAACGTTGTCCATTTGCACTATCAACAACGTACC
GCACGTAAATGTTTGACTATCATCCAAGGACTCGCAGACGACCTTGACTACAAGAAAATT
CTCCGTGCTTTTAAAAAGCTATTCAACTGTAATGGAACCATCGTTGAAGACGAGGAGATG
GGCACTGTGATTCAGTTGCAAGGAGACAACAGAAAAAGTGTTGCCAAGTTCTTGGTTGAA
GAGGGAATCGCCACCGTCGAAGAAATCAAAATTCATGGTGCTTGA


>Contig4801.0.g31(protein)
MSEDQSKKLKKGTKKPTKAEENETRGGGMEIINFGGDNVDEDFEKQREHNVVHLHYQQRT
ARKCLTIIQGLADDLDYKKILRAFKKLFNCNGTIVEDEEMGTVIQLQGDNRKSVAKFLVE
EGIATVEEIKIHGA