Identifiers and Description

Gene Model Identifier

Contig21912.0.g40

Standard Name

EFTUD2

Aliases

Contig21912_0_g40

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000799109.997093137033517e-262Elongation factor G, domain IV
family protein
SGDYOR133W2.0004882463825047e-175EFT1 SGDID:S000005659, Chr XV
from 575098-577626, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21912.0.g40(coding)
ATGGACGAGGACTTGTATGACGAATTCGGAAATTATATTGGCCCTGATATTAATCAGGAC
TCATCAGATGAAGAGAGAAGAGATGGAGGTCGTAACGAAGACGATGAGGGATCAGATGAG
GAAGATCGGGATATGCAAAGAGCCAGAGGAAAGTAATAGCGGGATGCAGATGAGGGTTCT
TCAATGAGGGACGAAGATGAAGAAAAAGACGAGGAGTACTTTAAGAGTGGGTATTAAGTG
GTCTTGCATGAAGATAAGAGATATTATCCAGAGGCAGAAAAAATCTATGGACCTGGAGTT
GAAGCATTAGTCATGGATGAAGATGCCTAACCTCTAACTTAACCAATAATAGAACCACCC
AGAGATAAGTCATTTTATCTCTTTGAGACAGAGATTCCTTCAACTAACTACTCTTTGGAA
TATCTCTCAGCTCTTTCTACTAAACCATAACTGATAAGAAATGTTTGCATAGCTGGTAAC
TTACACTCTGGAAAAACTTTACTATGCGATATGCTGATTCAACAAACCCATACTTAGAAA
AATTGGGATTTGAATAAGGAATATAAATGGATGGACACTCGTAAAGATGAGGTTGATAGA
AAAATGAGCATCAAGGGAGTGCCTATGACTCTTGTACTTCCAGACTCCAGAGAGAAAAAT
TATCTTTTCAACTTTATGGATACTCCAGGACATCCAAATTTCTCTGATGAAGTTACAGCA
GCTGCCAGAATAAGTGATGGCATGCTTTTAGTGATTGATATTATGGAAGGAATCACATTT
TACTCTGAAAAACTAATTAAGGAAGCCTTGAGAAACAAAATGGACATTGTTGTAGTTATA
AACAAGCTTGATAGGCTTGTACTGGAATTAAGACTACCTTTGAATGATGCTTACCATAAA
ATCAAGCATACTCTCGATGAAGTAAACTATATTGTTCAGACTTTCCAATTTCAACTGAAT
TCACAAAGCACAAAAGGTAGATTTTAATCAACATAGAAACAGATTTCACCAATTAACAAT
AATGTGCTCTTTGCTTCAACAATCTTTGGTTGTATATTCAGTATATAATCATTTGCTCTG
AGATATACTCAAATGTATCAAGATTAATCAACATAGTATCAAAGACATGGCTAGTAGGTT
AAGAATGAAGTTATTGATCCCTCTAAATTTATTAAGTTTCTTTGGGGAGATATTTATTAC
AATGAGGAAACTAGAAAGTTTCAAAGAAAATCTGAAGGTTTATCAAGAAGTTTTATTCAC
TTTATATTAGAACCTTTCTACAAACTAGTATCACATGTCTTAAGTAATGAAAGAAATGAA
TTAATGCCAATTATGAAAAAGCTTGGTATATTCTTGAAGAAAAAAGATTATTAGCTTGAC
ATTAAACCTTTACTGAAGTTGGTCTTGACTAAATTCTTCGGTAATACAAGCTGCTTAGTT
GATAGTATGTCAGAAAGTTTTGTCAATGCTTTGGAAGGTACAAAAATCAAAGTTAATAAC
TACTATAGAAATTCTAACGATAACTCCGATATTTTGAATGAAATCTCAAAGTGTGATTCT
AAAAATAATCTAGTCATTAATATCGTTAAATTGTACTATAATGAAAGTAATGGGCATTTC
CATTCTTTAGGAAGAATCATTTCTGGAACTGTAAAGAGAGGTGATGAAGTCAAGATCTTA
GGGGAAGGATATACTTTGGAAGAAGAGGAAGATATGGTTCACAAAAATATTAGCAAGCTG
TGGATTATGCAAGCAGGTGGAAGATATAAAATTGATCTAGATATGATGACTGCTGGAAAC
TGGGTTCTTATAGAAGGTGTTGATGCATCTATAATGAAAACTGCAACAATTGTAGGTGCT
GATTTTGAGGGTGTTGATATTTTTAAACCTCTTGACTTCTAAACAGAATCTGTCATTAAA
GTTGCATTAGAACCACTTAATCCAAGCGAGCTACCTAAAATGTTAGAAGGTTTGAGAAAA
ATAAGTAAAACCTATCCTCTCGCTAAAACTAAAGTGGAAGAGTCTGGTGAGCATATTATA
ATTGGAACAGGAGAGCTATATATGGATTCTATATTCCATGATTTAAGAAAACAATATGCC
GAAATAGAAATTAAGGTAAGTGAGCCATTCACATCTTTCTGTGAAACTGTAATTGACACT
TCATCAGTAAAATGCTTCGCTGAAACTCCGAACAAGAAAAATTAAATCTAAATGATTGCA
GAGCCCCTAGATAAAGGTCTTGCAGAAAATATTGAAGCAGGCATGTTTGATCTTATACCT
GACATGCTTGTTGATAAATATTAATGGGATGAACTTACTGCTTAATCGGTTTGGGCATTT
GGTCCACATAAAAAAGGAACAAATATGTTAATTGATTATACTCTATCTTCTGAAGTTGAT
AAGTAGAGACTTGGTCAAGTTAAGGATATGATAGTGTAAGGATTTTAATGGGCAACTAAG
GAAGGACCCTTATGTGAAGAACCAATAAAAAGTTCAAAGTTCAAGATCCTCTATGGAAGC
TTTGCAAATGAACCAATCTATAGAAGTGGAGCTCAAATTATACCAACTACAAGAAGAGTA
TGCTATAGTTCATTCTTACTTGCATCTCCAAGAGTCATGGAACCTATTTATTTAGCCGAA
GTTCATTGTCCTCAAGATTGCATTGAAGCTATTTATAACGTTCTATTAAGAAGAAGAGCA
CATGTTGTTCATGAGGAACCAAAACCAGGTTCTCCTCTATATGTAATGAAAATTGAAATC
CCAGGCATTGAATCTTTTGGATTTGAGACTGATCTTAGAACTCACACTGTAGGCTAAGCT
ATGGTACTATCTCAATTCTCTCATTGGGCTGTTGTTCCAGGTGATCCTTTGGACAAGTCT
ATCTAATTGAGACCATTAGAGCCAAGTCCAGTTCCTAGTTTGGCAAGAGAATTTATGGTC
AAGTCTAGAAGAAGAAAGGGATTATTAGAGGACGTAAGCATCGCTAAATTCTTTGACAGT
TAAGCTATGATAGAATTAGCTAAAAACGATCCCTCTTTGCAAGCATACTTTTGA


>Contig21912.0.g40(protein)
MDEDLYDEFGNYIGPDINQDSSDEERRDGGRNEDDEGSDEEDRDMQRARGKQQRDADEGS
SMRDEDEEKDEEYFKSGYQVVLHEDKRYYPEAEKIYGPGVEALVMDEDAQPLTQPIIEPP
RDKSFYLFETEIPSTNYSLEYLSALSTKPQLIRNVCIAGNLHSGKTLLCDMLIQQTHTQK
NWDLNKEYKWMDTRKDEVDRKMSIKGVPMTLVLPDSREKNYLFNFMDTPGHPNFSDEVTA
AARISDGMLLVIDIMEGITFYSEKLIKEALRNKMDIVVVINKLDRLVLELRLPLNDAYHK
IKHTLDEVNYIVQTFQFQLNSQSTKGRFQSTQKQISPINNNVLFASTIFGCIFSIQSFAL
RYTQMYQDQSTQYQRHGQQVKNEVIDPSKFIKFLWGDIYYNEETRKFQRKSEGLSRSFIH
FILEPFYKLVSHVLSNERNELMPIMKKLGIFLKKKDYQLDIKPLLKLVLTKFFGNTSCLV
DSMSESFVNALEGTKIKVNNYYRNSNDNSDILNEISKCDSKNNLVINIVKLYYNESNGHF
HSLGRIISGTVKRGDEVKILGEGYTLEEEEDMVHKNISKLWIMQAGGRYKIDLDMMTAGN
WVLIEGVDASIMKTATIVGADFEGVDIFKPLDFQTESVIKVALEPLNPSELPKMLEGLRK
ISKTYPLAKTKVEESGEHIIIGTGELYMDSIFHDLRKQYAEIEIKVSEPFTSFCETVIDT
SSVKCFAETPNKKNQIQMIAEPLDKGLAENIEAGMFDLIPDMLVDKYQWDELTAQSVWAF
GPHKKGTNMLIDYTLSSEVDKQRLGQVKDMIVQGFQWATKEGPLCEEPIKSSKFKILYGS
FANEPIYRSGAQIIPTTRRVCYSSFLLASPRVMEPIYLAEVHCPQDCIEAIYNVLLRRRA
HVVHEEPKPGSPLYVMKIEIPGIESFGFETDLRTHTVGQAMVLSQFSHWAVVPGDPLDKS
IQLRPLEPSPVPSLAREFMVKSRRRKGLLEDVSIAKFFDSQAMIELAKNDPSLQAYF