Identifiers and Description

Gene Model Identifier

Contig11501.0.g39

Standard Name

EFTUD1

Aliases

Contig11501_0_g39

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam00679 ) Elongation factor G C-terminus
  • ( pfam01926 ) 50S ribosome-binding GTPase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002906609.997093137033517e-262Elongation factor Tu GTP bindi
ng domain conta...
SGDYOR133W4.9996115996408327e-110EFT1 SGDID:S000005659, Chr XV
from 575098-577626, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11501.0.g39(coding)
ATGGTAGAATCAATTAGCAAACCTTAACCTTAATAATAACAACATCAGGAATAACCCCGT
GGATTGACGTGGCATGAGAAAGTGCAGGAATTGCAACATATTCCAGAGCGTATTAGAAAC
ATCTGTGTATTAGCACATGTAGATCATGGAAAAACCAGTCTCACTGACTCACTAATTTCC
TCTAATTAGATTATAAATAGCAAGCTAGCTGGCACACTTAGGTATTTAGATTCAAGAGAA
GACGAGTAGCAAAGAATGATCACTATGAAAGCAAGCAGTATCTCATTACTATATTAGCAT
TAAGTACCGGTTAGGAGACTGCCAGGGTAGTCTCCCACAAAAACTAATGAGGAAGGTAAA
TAAGTTCCTGTACCCCCTTAATATGAAGAGAGACAGTATTTGATAAACTTGATGGATTCC
CCTGGTCACGTCGATTTTTCATCTGAAGTGTCTTCAGCACTCCGCCTATCAGACGGTGCC
CTGGTTTTAGTAGACGTTTTAGAAGGTGTCAGCGCCCAGACCTACACAGTTTTAAGGCAG
GCATTCGATGAAAAAGTGAAAACCTGCTTGGTCTTAAATAAAATTGACAGACTGATTATT
GAGAAGGAGATGAATGCAATGGAGATATATATTCATTTGAACTAAATCGTGGAGCAAGTT
AACTCAATTGTCGCTGAGTTGATCTCGAAAGACTATCTTACTGCTGCTTAGAAGGGTGGC
AAGTAAACTGTTAATGGAGAGAATGAGGTTGATACCACTGGAGATGATGTCTTAGAGTTA
GATGAAGAACTCCTAGAACAACAAGAAAACGAGCTTTTCTTCTGTCCTGAGAAGGGAAAT
GTAGCTTTCTCATCTGCTCTGGACTGCTGGGCCTTCAATTTGACTGGTTTCTCAAGGAAA
ATTGCATAGAAATTTGGAATGAACCCCAGGAAGCTTTAAGAGTTCTTATGGGGTGATTTC
TATTTCAGCGGCTAGAAAATTTATAAGGAATCACAATCTAGCAATGGAAGACCCATGTTT
GTGCAATTTGTTATGGATCCATTGGTTAAAGAGTACAATAAGTTATTTAATAGCGATATG
CTGACCAATTCTGCTGAGTATAAGGAAGCTCGTAACAAGATCAAAACATTATTTTCTAAA
TGGATGCCAATGGAGAAGGGTATTTTAAGCATGATAGTCTAGCATATACCTTCACCAAAT
AACGCCCAAGCCTCACGTATGCCAGTTATCTGCCCATCTATGTGTGTGGATATGACTCAG
AAATACGAGAAACCTGAAGACATAGAAGAAGCACAAAAAATATAATAAGCAGTTTTTAAC
TGCAAGAATCAACTGAGTCAACCTGTAGTCCTATACATCACTAAAATGCAGCCAGTCAGC
TCAAGGATCTATGATATAGTAACCAGGGCTTAGAACAAGTCAGAGTCATCAGTGAGATTT
GTGGCATTTTGTAGAGTATTTTCTGGAACTTTAAAAACAGGTCAAATGGTTAATGTCATC
GGGCCAAAGCACGGTATTAATGATCAGGTTGATATCAAGGAAGCCAAAATTGACCACATC
TTCCTGTTAATGGGTGGTCAGAACATCCAAATTATAGATGAAGCACCCGCAGGTACAATT
GTTGGCATCGCTGATTTGGAGGATATCGTGCTCAAGACAGCCACTGTGTCTACATCTACT
CTTTGCCCTAATTTCAGCAAGTCCAAGGCCATTTCACAAGGACTGGTCAAGGTTGCACTG
GAAACTGAGAATTTAAGCGATATGGAGACACTCAAGAGAGGGCTTATCAAGTTGGACAGG
TCTGATCCATCTGTACAGTTTTACATAAACCATTAGGGTGAATATATCTTATCTACTTGT
GGAGAGATTCATTTAGAACGCTGCATTAAAGATCTCCAGGATGATTTCGCAAAAGGAGTG
AAATTTACCCATTCCGATCCAATTATAACCTTCAAAGAGTCAATTGTAGGTCAAGTGTTG
ACTGATAAGCGCAAGAAAGTCAAGGGAGTAGGTTGGGAAGAGATTGACTCCGAAAGTGAA
GAAGAAGTCGTGGAAGAAGAAAAGAAAGAAGAAGAGAAGACTCTAGCTGATATCATGGCT
GAATATGAGAAAGTTAACTAGCAAGTACAGAAAGAGCGTGAGTTTTTACGTAAGGAAATG
AAACCAGACATGTACATTGAGAAAACTCTGTTTAATAAGTACTATTAAAATAATGCCAAA
GCTCTGGCTGCTATTGGATATTAAAGATCATGTGCGACTGATAAGACAGCAAATTAGAGA
TGCCAGATAAAAGTACGAGCAGTGGGTTTGAACTGGGAAGTGACTAAATGGCTTGAAAAT
TAGCACAAAACCATCAGCTAAGTTTATCATTTAGTGGAAAGTGTGAAGAATGAAGGAGCT
CACCCCAAAGTCTAAGATGTGGAATTAGCGTTTAATTTCATTAAGAAATTCAGAGACTTG
ATGATAGAGAAAAAAACCAACAATAAATTAATCAGATTAATTGAAGATAAATTGCAGTGT
TTTGGGCCTAAGAGAAAGGGACCAAACCTCCTACTCAATAAATTCACAAAATCTGAGGAT
TCATTCATATAGACAATATACAAACTAGCCAGGGAATATTTGGAATTAAGCGAATCAGAT
TTGATTATTATCAATAATGTGGATAGAGCTAAAGTGCTTGGGCTAGATGAAGAGGAAAGC
CAAAGAGAGTAGAGACTTCAGAGAATGGAGAAAAACGATAATCACAGAGAAAACAAAGTT
AATTAAGTTTTGGAGTATCAAGAAATATCTCATCGTGACATGTCAAATGCTTTTATGACT
GGCTTTGATATTGCAATATAGGCAGGTCCATTATTTGAGGAACCCATGCTTGGAGTTGTC
TTTATTATTGAAAACATTGACCTCACTTTGGAAGATTCTTAATAACATAGCAGCAATCAA
GACCAAGAAGAAGAAAAACAACAATAAAAGAGCACTGACACATATGGCCCATTCACTGGT
TAACTGATAGCAACAGTCAAGGACCTTTGTAAGAAATCTTTCCTGAATGCAGAACCCAGA
GTTGTTGAGGGCATGTACCTCTGCTCACTCATGGCCACCCCAGAAACCTACGGAAAAGTC
TACGGAGTTATAAATAAATGCAGAGGAAGAGTCATAAAGGAAGATATTCAGGAGGGCACA
AACAACTTCTTGATTGATACCCTTATACCCATCGGGGAATCTTTTATTTTCTTGGAAGAT
ATCAGGAAGAAAAGTTGTGGTATTGCATACCCCTAACTCGTGTTTCATGGGTTTGAAATC
AATGAAAACGATCCGTTCTATATTCCAGTTACTGAAGAGGACTTAGAAGATCACGGAGAA
GGTGACATTTTACCACCAAATCCAGCTAAAATAATTATTGAAAAGGTCAGGTCAAGAAAG
GGTCTCCCAGTTGATAAGAAAATTGTAGTTAGTGCTGAATAACAAAGAAATTTAGGTAAA
AATAAGTGA


>Contig11501.0.g39(protein)
MVESISKPQPQQQQHQEQPRGLTWHEKVQELQHIPERIRNICVLAHVDHGKTSLTDSLIS
SNQIINSKLAGTLRYLDSREDEQQRMITMKASSISLLYQHQVPVRRLPGQSPTKTNEEGK
QVPVPPQYEERQYLINLMDSPGHVDFSSEVSSALRLSDGALVLVDVLEGVSAQTYTVLRQ
AFDEKVKTCLVLNKIDRLIIEKEMNAMEIYIHLNQIVEQVNSIVAELISKDYLTAAQKGG
KQTVNGENEVDTTGDDVLELDEELLEQQENELFFCPEKGNVAFSSALDCWAFNLTGFSRK
IAQKFGMNPRKLQEFLWGDFYFSGQKIYKESQSSNGRPMFVQFVMDPLVKEYNKLFNSDM
LTNSAEYKEARNKIKTLFSKWMPMEKGILSMIVQHIPSPNNAQASRMPVICPSMCVDMTQ
KYEKPEDIEEAQKIQQAVFNCKNQLSQPVVLYITKMQPVSSRIYDIVTRAQNKSESSVRF
VAFCRVFSGTLKTGQMVNVIGPKHGINDQVDIKEAKIDHIFLLMGGQNIQIIDEAPAGTI
VGIADLEDIVLKTATVSTSTLCPNFSKSKAISQGLVKVALETENLSDMETLKRGLIKLDR
SDPSVQFYINHQGEYILSTCGEIHLERCIKDLQDDFAKGVKFTHSDPIITFKESIVGQVL
TDKRKKVKGVGWEEIDSESEEEVVEEEKKEEEKTLADIMAEYEKVNQQVQKEREFLRKEM
KPDMYIEKTLFNKYYQNNAKALAAIGYQRSCATDKTANQRCQIKVRAVGLNWEVTKWLEN
QHKTISQVYHLVESVKNEGAHPKVQDVELAFNFIKKFRDLMIEKKTNNKLIRLIEDKLQC
FGPKRKGPNLLLNKFTKSEDSFIQTIYKLAREYLELSESDLIIINNVDRAKVLGLDEEES
QREQRLQRMEKNDNHRENKVNQVLEYQEISHRDMSNAFMTGFDIAIQAGPLFEEPMLGVV
FIIENIDLTLEDSQQHSSNQDQEEEKQQQKSTDTYGPFTGQLIATVKDLCKKSFLNAEPR
VVEGMYLCSLMATPETYGKVYGVINKCRGRVIKEDIQEGTNNFLIDTLIPIGESFIFLED
IRKKSCGIAYPQLVFHGFEINENDPFYIPVTEEDLEDHGEGDILPPNPAKIIIEKVRSRK
GLPVDKKIVVSAEQQRNLGKNK