Identifiers and Description

Gene Model Identifier

Contig4749.0.g68

Standard Name

EFH6

Aliases

Contig4749_0_g68

Description

Ca2+ insensitive EF hand

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4749.0.g68(coding)
ATGGGCTGTATGATGAACAATTATAATTGTTGCTCCGCTGGTTCTCAAAACTTTTATGTC
ACACCTGATGGTTTTGAGTAACCAAGAAAAAACTTGCAAAAACTTGCAAGAAATGGCCAG
AGAAGAAATGAGGAAAGAAAATCTGGAGAGGACATTGGCAAAAAGGAGCACGATGATGAA
TTTGATTATCAAAAGGATGGTGAAAGGGATGGCGGTGCTGGTGGCAATGGCGATGCCAAT
GATGATGGCGGTACTGATGATGATCTAGACGAGCACCAAGACGACGACGAAGAGAGACAC
TAGGAGAATGCGAATCAAAATCAGCTACTCGGTATGAATGAAGTTGAAAAAAACCTCGCT
GAGGAGGAAGAGCTAAGACTCAAATTGATCGCTGAAGAAGAGATGAGATAGAAGCAAATC
GCTGAAGAAAATGACTAGATTGCAGAAGATTTGAGGTAGCAGTTAGCTGAAGAGGAGGAG
TAGAAAATATAAGATGCTTATGACCTTCACAGACTATTTTTTCCACAATAATACGACAAC
GTTGTTAACCCCAATCAGCCACCCAGTAGATTCGATTGA


>Contig4749.0.g68(protein)
MGCMMNNYNCCSAGSQNFYVTPDGFEQPRKNLQKLARNGQRRNEERKSGEDIGKKEHDDE
FDYQKDGERDGGAGGNGDANDDGGTDDDLDEHQDDDEERHQENANQNQLLGMNEVEKNLA
EEEELRLKLIAEEEMRQKQIAEENDQIAEDLRQQLAEEEEQKIQDAYDLHRLFFPQQYDN
VVNPNQPPSRFD