Identifiers and Description

Gene Model Identifier

Contig22623.0.g32

Standard Name

EFH5

Aliases

Contig22623_0_g32

Description

EF-hand domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22623.0.g32(coding)
ATGGAGAGTTCTACATAAATAAACACTGTCGTGGATTAAGACTCTGAGAAGATTATTCAT
AGAGACATAGAAGGTTTAAAACAGCAAATCAAAGAATAATGCAGTAACTTGAATGATGAA
CACATTTAGGACATAGTGGAAACCTTTAATACTTTTGACTTTGACGGAGAAGGTTTTGTT
TAAGAAATTGAGGTAGTGGCTACTATGTTAATGTCCATGAATTGTGATGTTACTAAGCAA
ATGATACTAGATTTGCATCAAGATCTCTTTAATGCTAAATTTGAGGAAGACACAGAAATT
ACGATTGTTCAATTTGCTAGGATGGTAGATCATTTCGTATAAGAAGCTGACCCAGTAGAT
GGAGTTATTGCAACTATATAGGAATCATATGATGAAGAAAGCACTGGGAAATGTAAATTC
TCAGACATTATCAAATTCATGGAAGAATATAACTATCTAGAGGCTGATCCAGAATCATGC
ATGAAAATTTTAACAGAATTTAAAGATTCAAATGATAACATAGAGTATGCTATAGCTATG
AAGAAGTTAATTTAATGA


>Contig22623.0.g32(protein)
MESSTQINTVVDQDSEKIIHRDIEGLKQQIKEQCSNLNDEHIQDIVETFNTFDFDGEGFV
QEIEVVATMLMSMNCDVTKQMILDLHQDLFNAKFEEDTEITIVQFARMVDHFVQEADPVD
GVIATIQESYDEESTGKCKFSDIIKFMEEYNYLEADPESCMKILTEFKDSNDNIEYAIAM
KKLIQ