Identifiers and Description

Gene Model Identifier

Contig14911.0.g37

Standard Name

EFH2

Aliases

Contig14911_0_g37

Description

EF hand

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004184700.0000000010002658722841845EF hand family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14911.0.g37(coding)
ATGTCAATTCATCTAAATTCAAATAACTTGAATAAGTTAAATGAAGATAAACTAAGCAAT
TCTTAGAAGTTTTCTAGCAATAAAATGAGAGCACAATCCCAATCTAATAAATCTCAACTG
CTCAAAAATATTGATAATGATAAAAGCGACTATGTACTCTTGCAATTGTTTAATGATATA
TTGAAATTGCATAGTGTTGAGCTCCGAGAATCAGACAAAAATAGATTGAAGCAGAAGTAT
GTCAAGAGTATAAGCGGCCAAGATAAAATCCTCTATAAAGAAGCTATTGCAGCTTTACAC
ATTGATTTATCTCAAGTGAATTCCCTATAGTAAAACAGTGGTTTTAAACCCTAATGGATC
TTGAGGAATATCAACCAAAATGACTTGAGAAATCAATCTACAGATGAAGCAAAGTCAATC
TAGAGATTTATTAATAGCGAGTATTCACCTAGTATAGCTAACCAACTAGACAATTTGAGT
TTGTTTTCAGGCTTTAGTGGTCTTAGGAGCGTTAAATTGAGTGAGAGAATGAAAGGTAGT
GCGGAATAGAAATCCTAAAATGATGGAATGGAAATTGAAGTTCTAAATCCTGAATTGCAT
TCGATTAAAAAGATTATACCAGGAAAGCTATAAACTCCCAGCCATTTATCTAACATGAAA
TCTATATCATTAGAAAATAGCTCTAAAGGGTTTCAAAATGGATACCTCAAAGTAGGAGAT
TATTCTACTGTACAAAATAAGAATTAATAAATTATGATTTTCAATTAGAAAATCAGCTAT
CTATATGAAAATGATCCTAATAGATATTAAAAAATCACAGATCTGAATAAGCTGTTCTTA
AATAAAGAGATATCAATAGATGAGTTTAAGACCATGCTGTCTTTCTCTTTAAATTTACCA
CAATCAAAGTCTTAAATCATAGATGATTTAGTAGAAGCGATTCACCTTATTAATCAAGAA
ACTCTAACTGTCCAGCCTTTCTTTACAAAATAATTAATAGATGACTTTTTCAATCTATGT
CATTACTGGCCACTGTAGATTAAGAGAGACTCTAATCAGTCCTCTAATATGTACAAAGTG
CTAAATTCATCGAAAGCCAAAGATTTCAATACTTCTCTAGATTTTCATAAGACTCATAAC
TCGATAATAAAGAGCGATATATTCAAGCTTTATGAAATGATTTGGAGTAAGATATGCGAG
AAGTTTGATAAGATAAACTTAGCTTACAAGTTTTTCATTGGTGTAACAACAAATAAAATT
GCATTCAATGACTTTGTAATTGGATTAGAAAATTTGAGACTCAAGCTCACAACAAGAGAG
ATAAATGATGTGTTTGAAAGCCTCGATAAAGACAGAGACGGTTACATCAGCTATTTAGAG
TTTTGTTAACTCTCCGAAGAAAAGAGAAGGGGCATAGATCCTTTTGAGAATGATTAAATG
CACAGAGCTAAAGAGTATTTTGAAACACAAAGGTAAAAACTTTCAACTTCAATGAATGCA
CGGATTCCTTAATTAAGAAACAAAACTTTCATGAATCTTACCCTTCTTCCACCTAAAATA
GAAGATCCATAAGAGGGTAAAATCTCAGTTGAAAAAGACTACATGCTGAATACCTATGCT
TTGCATAGAAATTTTAAGACAAGATAACTTCAGAGAATGATGAATATTTCTTAAGGGGAC
TATCATGGGAAGTAAAGTATGTTATCAGATAATATTGATGATGTACTTGCCCATCAATTC
ACACCTTTCTTAGTTGAAAATCCAGGAGATGCTACTTAAAGAGTGGCAAGACATAGATAA
AATCAAACTATATCCTATAATACAATCAGCTCAAACGAAAAAGGTGATAGTAGTTTCAGA
AATAAGATATTCAAGAATTTCCATACAAAGACAAGTTAATTAAGAGGTTAGTCTCTCAAA
AAGAATTTATGA


>Contig14911.0.g37(protein)
MSIHLNSNNLNKLNEDKLSNSQKFSSNKMRAQSQSNKSQLLKNIDNDKSDYVLLQLFNDI
LKLHSVELRESDKNRLKQKYVKSISGQDKILYKEAIAALHIDLSQVNSLQQNSGFKPQWI
LRNINQNDLRNQSTDEAKSIQRFINSEYSPSIANQLDNLSLFSGFSGLRSVKLSERMKGS
AEQKSQNDGMEIEVLNPELHSIKKIIPGKLQTPSHLSNMKSISLENSSKGFQNGYLKVGD
YSTVQNKNQQIMIFNQKISYLYENDPNRYQKITDLNKLFLNKEISIDEFKTMLSFSLNLP
QSKSQIIDDLVEAIHLINQETLTVQPFFTKQLIDDFFNLCHYWPLQIKRDSNQSSNMYKV
LNSSKAKDFNTSLDFHKTHNSIIKSDIFKLYEMIWSKICEKFDKINLAYKFFIGVTTNKI
AFNDFVIGLENLRLKLTTREINDVFESLDKDRDGYISYLEFCQLSEEKRRGIDPFENDQM
HRAKEYFETQRQKLSTSMNARIPQLRNKTFMNLTLLPPKIEDPQEGKISVEKDYMLNTYA
LHRNFKTRQLQRMMNISQGDYHGKQSMLSDNIDDVLAHQFTPFLVENPGDATQRVARHRQ
NQTISYNTISSNEKGDSSFRNKIFKNFHTKTSQLRGQSLKKNL