Identifiers and Description

Gene Model Identifier

Contig4717.0.g106

Standard Name

EFH1b

Aliases

Contig4717_0_g106

Description

EF hand

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009619302.0004286606204839e-16EF hand family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4717.0.g106(coding)
ATGTCTTAAATTAATGAAACCCAGGCAGAATTAGATGAAACCATAGAAGAAAGGTCAAAG
AACACTCATGAGTATTTACAAAAGTCTAGGAAGATTAGCAAGTAATTGAACTAATTTAAT
GTGAAAAAATGGTTACAAAAACGGTGTAGCGAACGTGCAAAACCCTTTTACTTGAAATCA
GAGAATGAACTAAAGTAGGAACTTCAAGTAGAAAATGTTTTCATAAACTTTGACGACGAT
GGATCAAATTCCCTTGACTGCCAAGAAATATTCGAGATGTTTCATAAAAACGGGATTATA
ATATCTATGAATTAGATTAAAGAGTTATTTAAGATTGTTGATGAAGATGGGTCAGGATAG
CTTTCGCTTGAGGAATTCAAATTATTCATGTTTTCAGAAGTAGCAAACAATAAATTTAGA
CAGATTATCACAAAATTTAGAGAGAGAAACGATTTGTACTAAGGCTGCATCCCCTTCAGT
TTTAACATTATGTTGGAATATTTAAGCGAAAAAGTGAACAGACAACAGCTTCATGAAGAT
ATACTAGAACTAGGTTTAAGCACTTAAAATATAGATGAAACTTTAGCAAAATTTAAAGAA
TTATTCAGTTAAAGCAAGCTTTCTTTGGAAAAAGGGATAGCTTCTACATTAGCTGTAAAT
TCTAAAATCCCTATTGACATTGATGTAATCAAGAGGATGGTTGCTTAATAAGATAAGGAT
TTGAAAATACAATAGTAAGGTAGCAGCGATGATAGTTAAAATAAGGGAAGCTTCTAATCA
TCACCTGATAATATGTTATTTAATAACAGCAGTATGAATAGCTAAAATACTAAAAGAAAT
GATGTATAAGAAAGAAACAATTATATCACATTAACTACTATTGATTCAGTTGAGTCAAAG
AACGATTCAAAGTCACATAAAATTTCAGAAGATAATCTCAATAAAGAAAAGTACTTGTTC
AAAGAAAAACTTAGAGATATAATTATCAAAGCTAGATAGAAAGGGAAAGTGGATGCTGTT
TAAGAATACTAAAGTATAATTCTTAAAAAGCATAAAGACTATAGGGAAAATTACTTTCGC
CATTACAATAATCGATCTAAATCAAGAAATAAGATAAATTCAGAAAATTTCACTTAAAAT
TTTATAGTCAAAGAAAACTCAGGTAGTCCACTTAAAATACTGACTTAAAAAGTTTAGCAT
TAGAAGAAAGATTTAATGAGATAGTTAACTGAAATAAAAAATGAAAAGACTTAAGAATTA
CAATAATAAAACATCAACAGAAATGGACCTCTAACCAGACCTAAGACATCTCTACCACCA
AGATAGAAGAAAAATTATCTACATAATTTAAGTATATTAAACTAGAACAATGTACATGAA
AATAGCAATCGATCTATACCTAATTTGAAATATAATAATGATAGCAAGTTTTAATCTCCA
TTACCAACAAATCTCAATACTTATAATTAAACTAGATGTGTAAGTGGCCATCCAAAACTC
TAAAAAACTATCTCTCATAAGGGCTTATTTTCAAATAAGTTATTCTTTGACAAAGGCAAC
TAAAACATAAAAAGTAATAAGACTTTAATGAATAAAACTACTGTCGGTGGATTTATAAAG
AACCCACTCTCAAACTAGAATTTCAATTAAAATCTAAATAGTTTATCTACGACTGGTTTA
ATTAAAGCAGTAAGATAGCGAGAAAAGGATTATATGTCTAAAACTATTCACTCATTTGGG
ACTCATATGAATTCTACCACTCAAAATTCAACTTAGTAATTGCATTCTCATACTTTCTAT
AATAATAAATCTAAAATCCATTTTAATGATACAATAAAGATAAGAAACAAGTCAGGGCAC
TCCCTTCATAAACTCAAGTAATAGTAGTAATACTAAAATAATCATTATTTAAATCAAACA
GAGTCCACTAATGCTAACTCTAGGTCTTGGATTTTAAATTTATGA


>Contig4717.0.g106(protein)
MSQINETQAELDETIEERSKNTHEYLQKSRKISKQLNQFNVKKWLQKRCSERAKPFYLKS
ENELKQELQVENVFINFDDDGSNSLDCQEIFEMFHKNGIIISMNQIKELFKIVDEDGSGQ
LSLEEFKLFMFSEVANNKFRQIITKFRERNDLYQGCIPFSFNIMLEYLSEKVNRQQLHED
ILELGLSTQNIDETLAKFKELFSQSKLSLEKGIASTLAVNSKIPIDIDVIKRMVAQQDKD
LKIQQQGSSDDSQNKGSFQSSPDNMLFNNSSMNSQNTKRNDVQERNNYITLTTIDSVESK
NDSKSHKISEDNLNKEKYLFKEKLRDIIIKARQKGKVDAVQEYQSIILKKHKDYRENYFR
HYNNRSKSRNKINSENFTQNFIVKENSGSPLKILTQKVQHQKKDLMRQLTEIKNEKTQEL
QQQNINRNGPLTRPKTSLPPRQKKNYLHNLSILNQNNVHENSNRSIPNLKYNNDSKFQSP
LPTNLNTYNQTRCVSGHPKLQKTISHKGLFSNKLFFDKGNQNIKSNKTLMNKTTVGGFIK
NPLSNQNFNQNLNSLSTTGLIKAVRQREKDYMSKTIHSFGTHMNSTTQNSTQQLHSHTFY
NNKSKIHFNDTIKIRNKSGHSLHKLKQQQQYQNNHYLNQTESTNANSRSWILNL