Identifiers and Description

Gene Model Identifier

Contig2949.0.g36

Standard Name

EFH1a

Aliases

Contig2949_0_g36

Description

EF hand

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009619300.000000000000005001692698841201EF hand family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2949.0.g36(coding)
ATGTCTTAAATCAATGAAACCCAGCCAGATTTAGATGAAACCATTGAAGAAAGATCTAAG
AACACTCATGAGTATTTGAAAAAGTCTAGGAAGATTAGCAAGTAATTGAACTAATTTAAT
GTGAAAAAATGGTTACAAAAACGGTGTAGCGAACGTGCAAAACCCTTTTACTTGAAATCA
GAGAATGAACTAAAGTAGGAACTTCAAGTAGAAAATGTTTTCATAAACTTTGACGACGAT
GGATCAAATTCCCTAGACTGCTAAGAAATATTCGAGATGTTTCATAAAAACGGGATTATA
ATATCTATGAACTAAATTAAGGAGTTATTCAAGATTGTTGATGAAGATGGGTCAGGATAG
CTTTCGCTTGAGGAATTTAAATTATTCATGTTCTCAGAAGTAGCAAACAATAAATTTAGA
CAGATTATCACAAAATTTAGAGAGAGAAACGATTTGTATCAAGGCTGTATCCCCTTTAGC
TTCAACATTATATGA


>Contig2949.0.g36(protein)
MSQINETQPDLDETIEERSKNTHEYLKKSRKISKQLNQFNVKKWLQKRCSERAKPFYLKS
ENELKQELQVENVFINFDDDGSNSLDCQEIFEMFHKNGIIISMNQIKELFKIVDEDGSGQ
LSLEEFKLFMFSEVANNKFRQIITKFRERNDLYQGCIPFSFNII