Identifiers and Description

Gene Model Identifier

Contig17787.0.g88

Standard Name

EEFSEC

Aliases

Contig17787_0_g88

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam10662 ) Ethanolamine utilisation - propanediol utilisation
  • ( pfam03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004088709.997639769646959e-151Elongation factor Tu GTP bindi
ng domain conta...
SGDYOR187W3.9990760533890984e-36TUF1 SGDID:S000005713, Chr XV
from 684030-685343, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17787.0.g88(coding)
ATGGTAGAAAGTTTACAGTCACAATCTGCTCATATAGAGCGCATTGATAACTCATAACAA
GATTTCTCAACTGCTAAAATTCTGAATATTAATATAGGGGTTTTGGGGCATATTGACTCT
GGGAAAACATCTCTATGCAAAGCTTTGAGTACAATAGCATCGACAGCTGGTTTTGATAAA
AATCCATAGAGTTAGGATAGAAAAATTACTTTGGATTTAGGTTTCTCTGCTTTTATCATC
AGAATTCCAGAGTGGTTCAAGGAGAAGCATTAAGATAAATTACAAAAAACATAATATGAA
TACTTACAGTTTACATTAGTTGACTGTCCAGGTCATGCATCGCTTATGAAAACCATTATT
GGTGGAGCTTCTATTATAGATTTAATGATGCTAATTATTGATGGATAGAAACTCATTCAA
ACATAAACAGCTGAATGCATTGTATTAGGAGAAATCTTAATGGAAAAACTAATCGTAGTA
ATGAATAAGGTAGACATGTTTGAAGAAAGTAAAAGAGATGAAATGATATAAGTACAAACT
AAGAAACTTCAAAACAGATTTGGTTTTACAAGATTTGGTAGCAATGTCCCAATTATTCCA
GTAAGTGCTAATCCACGAGGATCTGATGAAAAATAAAGTTTAGAGGAGACTAAGGAAGAA
CCTCATCCTCAAGGAATCGATGAGCTTATCACAACAATTTTGTAAAATTTAGATATACCA
GAGAGGGTGACTAAGAATCAGCCTTTCTTATTATCGATAGATCATTGCTTCTAGATCAAA
GGTCAAGGAACTGTATTGACTGGCACAGTTCTATCTGGACAGGTTAAAGTTGGAGACACT
ATTGAACTTCCAGCTTTGAAACAAGAAAAGAAAGTTAAAAGTATGCAAATGTTTAGGAAG
CCAGTCTAGCTTGCAAAGTAGGGAGATAGAGTAGGTATTTGTGTGGCTCAATTAGACGCA
AGCTTAATAGAGAGAGGGATTGCGGCAGAGCCCAGAAGTCTCTAAAGCACAGATTTAATA
GTTGCACTTGTGAAGAAGATTCCATATTTCACAGAAGAAGTCAAGAATAAGGCTAAGTTT
CATATTACAATTGGGCATTAAACAGTCCTTGGGCAGTGTATATTTTTCTCAGCAAAAAAC
CCACTTGATATGGAAAATTATCAAGCTCATTTCAATAAAGGAGCACTAAGCAATGATAAG
CATTCAGTTGGCTTAGACACTTAAATTGAATACCAATTTGTCAGCGAAATTAAAGCTTAA
AAGTTAACTTAGCAAAAGAAGCCAGACTAAGAAGAAGAGAAGAAATCTACTTCATATGAA
GCTTCATTAGCTAAAGTACCAATATACTATTCAGTTATAAAGCTTGAAAGAGAGGTATTT
ATTCAACCTCAATCTCTCCTGATTGCTTCAAAACTTGATAAGGACATCTCTGCTAAACAG
TGCAGATTGGCTTTCTATGGCTAAGTTATATCACTAGCAGCTGGCTAAGACTAGGCTGCT
GCCCTATATAGCATAAAAATTGCCAAAGAAAAAATTAAGACTGGTAAGATCGATAGAATC
ATGAGCTCTACATAGGTTCTAATTAAGGATATATTTAAGAAAGAAACCTCAATAGAAGTC
TTTATGAATAAAACCGTTCTTCTAAAAGCCATAGGAGTTGAGGGCAAGATAACAGGGACG
TTTGGAAAAAGTGGGAAGTAGAAGGTTGATCTTAAGTAGGAAATAAGTGCTGAAGATATG
GATAAATTAGTTAATAGTGAAGTTGAATTGAAAGTTGTGGTTTACTCTAAGGAACTGGCA
AAATTAAAAAAGTGA


>Contig17787.0.g88(protein)
MVESLQSQSAHIERIDNSQQDFSTAKILNINIGVLGHIDSGKTSLCKALSTIASTAGFDK
NPQSQDRKITLDLGFSAFIIRIPEWFKEKHQDKLQKTQYEYLQFTLVDCPGHASLMKTII
GGASIIDLMMLIIDGQKLIQTQTAECIVLGEILMEKLIVVMNKVDMFEESKRDEMIQVQT
KKLQNRFGFTRFGSNVPIIPVSANPRGSDEKQSLEETKEEPHPQGIDELITTILQNLDIP
ERVTKNQPFLLSIDHCFQIKGQGTVLTGTVLSGQVKVGDTIELPALKQEKKVKSMQMFRK
PVQLAKQGDRVGICVAQLDASLIERGIAAEPRSLQSTDLIVALVKKIPYFTEEVKNKAKF
HITIGHQTVLGQCIFFSAKNPLDMENYQAHFNKGALSNDKHSVGLDTQIEYQFVSEIKAQ
KLTQQKKPDQEEEKKSTSYEASLAKVPIYYSVIKLEREVFIQPQSLLIASKLDKDISAKQ
CRLAFYGQVISLAAGQDQAAALYSIKIAKEKIKTGKIDRIMSSTQVLIKDIFKKETSIEV
FMNKTVLLKAIGVEGKITGTFGKSGKQKVDLKQEISAEDMDKLVNSEVELKVVVYSKELA
KLKK