Identifiers and Description

Gene Model Identifier

Contig19723.0.g13

Standard Name

EEF1Gc

Aliases

Contig19723_0_g13

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19723.0.g13(coding)
ATGTCTTAAAATAGCGGGATAATTAAAAGACCCTTTGTGCCTTTTGAGGACACGGAAGAA
GAGATTTATTCAAGTGAATGTCTAGATTCTTAGCCATCTAAAAAAGATTTAGATAAACCA
GAGAATTAAAATTCTTAGGATGCAGATGTTGAGGAGGTTGATAGTTGGGATGATCATAGT
CAAAGCGATTAAAAAGATGTTTAGGAATCACATGATTAAAGTTCATCGAGTGATAATAAC
CAATCATGTGATGACGATGAGCAGGGAGAAGACGAGCTTGAAGAATTGGAAAGTTAGAAT
CAAGAAGATGATTTAGAGCTGGACGAAGAGGGGAGACCCAAAGGTGTAAATAAGCTATTC
GACATGATTAAAAATGACTTGGGTGAGACTTAAAGCGAAAGCTTCAAGATCTTTTACGAT
TTAATGTCAAACCAGATTAAGTACTGCCTCTCTCAGTATATCAATGACGACGACGATGGG
GAAGAGGAAAAATAAGACAGTAAAGGGTTAGATGAGAAGTAATCACAAAAGCCAATAATC
AGCCCCATGGTTTTAATCAATCTGATTTAGTAACAAAAATCACTCATAATGAACGTTGTC
AACTAGAAAGAATAAGAAAAGGAAACATTGATTAGAGAAAAAGGAACTAAAAACAAACCA
TTGTAAATTTAGGCTGATCCTAAAGTTGTTTTAGATAAAATCAGGATTAAACTTCAACCA
AACGATTAATATACATTAACCTTTGCACAATAAAAGAACAATCCCTTAATTATGATAGTT
ACTGAGCCATCCAAACAGCTTAAAGTGATATTGGAATATTTGTCTTTGCAGTTTGGAATT
GAAGTGGATAGAATTTGCCTCTTATTCGAAAATAAACAAATAAACTACAACCACGACGAA
TTGAAGCTCTCTTAATTACTGTATTTTCTGGGAGGAGACATCTAAAATAAGGAGCGAAAG
AGCTAAAAATTGCCAACATATAATTTTAAATACGAATTCAGAGAACACCCAATTGAGTGT
AAAGAACCATAGATTAAGTTTAAAAATAAAGAAAAGGCTATAAATACCAAGAAATTATAA
GAATCTGAAAAAGTTATTAAATCGTCTTCAGATTAAGAAGAAGAGGATGAAGATTTAAAT
GAAGAGGAACTACTAGACATGTTTACTAACATATTCTCCTATATGGTGATTAAAAAGAAG
TAGAAGTAACTAAGATAAAACAATAACGATAAAGAAGCTAGACTACCCCACCCAAGCAGT
CTACTCCGCAAGAGAAAAAGAAAGTAATAAGACACTTTGAAGGATCTTCAAGAAAATATT
AGAAAAAGAGACGCTTCCAAATCTCACTTAAAACTTGAAAATATAGAGCAGCCGTTCGAT
AGAAATTTCTAAAATATTCATTTAAACCAGAGATTTGGCTCAGGTTTCCCAAATAATTTA
TCGAATTTCATGATTCCTCAAAATACTGAATAAATACTAAGCAATTCTGGTTAAAAGAAT
GGGGAGTCAATTTAACTGTATGATACAAATCCATATTTTCATTAATTAATGAAGTTTAAG
GGGAATTCTAAGTTTTAAGGGGGAGAGGAGAATATTCTAAATCAGAAAGAGTGA


>Contig19723.0.g13(protein)
MSQNSGIIKRPFVPFEDTEEEIYSSECLDSQPSKKDLDKPENQNSQDADVEEVDSWDDHS
QSDQKDVQESHDQSSSSDNNQSCDDDEQGEDELEELESQNQEDDLELDEEGRPKGVNKLF
DMIKNDLGETQSESFKIFYDLMSNQIKYCLSQYINDDDDGEEEKQDSKGLDEKQSQKPII
SPMVLINLIQQQKSLIMNVVNQKEQEKETLIREKGTKNKPLQIQADPKVVLDKIRIKLQP
NDQYTLTFAQQKNNPLIMIVTEPSKQLKVILEYLSLQFGIEVDRICLLFENKQINYNHDE
LKLSQLLYFLGGDIQNKERKSQKLPTYNFKYEFREHPIECKEPQIKFKNKEKAINTKKLQ
ESEKVIKSSSDQEEEDEDLNEEELLDMFTNIFSYMVIKKKQKQLRQNNNDKEARLPHPSS
LLRKRKRKQQDTLKDLQENIRKRDASKSHLKLENIEQPFDRNFQNIHLNQRFGSGFPNNL
SNFMIPQNTEQILSNSGQKNGESIQLYDTNPYFHQLMKFKGNSKFQGGEENILNQKE