Identifiers and Description

Gene Model Identifier

Contig20020.0.g85

Standard Name

EEF1Ga

Aliases

Contig20020_0_g85

Description

Elongation factor 1 gamma, conserved domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • eukaryotic translation elongation factor 1 complex (IEA) | GO:0005853

Molecular Function

Biological Process

Domains

  • ( pfam00647 ) Elongation factor 1 gamma, conserved domain
  • ( pfam00043 ) Glutathione S-transferase, C-terminal domain
  • ( pfam13410 ) Glutathione S-transferase, C-terminal domain
  • ( pfam13417 ) Glutathione S-transferase, N-terminal domain
  • ( pfam13409 ) Glutathione S-transferase, N-terminal domain
  • ( pfam02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004021209.99860868304602e-64Glutathione S-transferase, N-t
erminal domain ...
SGDYPL048W1.0004572433669413e-23CAM1 SGDID:S000005969, Chr XVI
from 464401-465648, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20020.0.g85(coding)
ATGAAGCTCTACAGCAACAGATAATCCGGAAACCTTTTCGTCGATATTGCCTACATCACT
GCCAAGCTCTCAGGTGTTGAGATCACTGAAGAAGTTGTCTCAGAAGAAGTCGCCAAGTCA
AAGGAGTTCAAGGCCAAGTCACTCACTGGAAAGTTCCCAGTCCTCGAGACCGAACAAGGT
GTCCTCGTTGAGTCAGCTGCCATCGCTAGATTCTTCGCTAAACACAGCACCAACGGACTT
TCCGGTGCCAACCACTTCGAGAGTGCTCAAATCGATCAATTCATTGATTTCTCAAACACA
ACCCTTGTTCCCCACCTTTACAACATCGTTAGAGCCGTCTTCGGTCTTGGTGTTGTCGAG
ACTGAAGTCTTCAACACCTCAGTCAAGGACATCAAGGAGCAAGTCAGACTTCTTAACACC
CACCTCCAAGGCAAATCATACCTCGTTGGCGATAGACTCACTGTTGCTGATGTTGTTGTT
GCTGTTGCACTCCTCTTCCCATTCCAACTCGTTCTCGATGGTGGATTCAGAAAGTCAGTT
GCCCCCAACGTTACCGCCTGGTTAGAGAGATTCGTCGCCCTTCCAGAAGTTGTCAGAAGA
CTCGGACACGTTAAATTCTGCGCCAAGCCACACAAGGCTGTTGCCCCACCCAAGAAAGAA
GAGGAAAAGAAACCAGCTGCCGCTGCTGCCAAGAAGGAAGTCACCGAGGATAACTTGATG
AAGAAGGAAGTTGACCCACTTGATGAACTCCCACCCAGCAAGCTTGACCTCAACGCATTC
AAAAACTACTACGTTAACCTCCCCAAGGAACAACAAAAGACTGAAGGTATGGACTACTTC
TTCCAAAACTACGACGCAGAGGGATATTCACTCTACTACGCCAAGTACGACAAGTACGAA
GGTGAGGGTGTCGTTCTTTACCAAACCAGCAACCTCATGAACGGTTTCCTCCAAAGAATC
GATAGCTTCAGAAGACACACCTTCGCCATGATGGCCATCGTTGGAGAAGTCCCCAACCTC
GACATTGAGTCAGTCTGGCTCTTCAGAGGAAAGGGTATCCCCCAACAAATGATCGACCAC
CCACAATTCGAATACTACCAAAAGAGAGAACTCAATGTTAACAACGAAGACGACAAAAAG
CTCATCAGAGAATTCTGGTCATGCAAACCAGGTGATATTGTCAACGGTAGACCAGTTGTT
GAGTGCAAGATGCACAAATGA


>Contig20020.0.g85(protein)
MKLYSNRQSGNLFVDIAYITAKLSGVEITEEVVSEEVAKSKEFKAKSLTGKFPVLETEQG
VLVESAAIARFFAKHSTNGLSGANHFESAQIDQFIDFSNTTLVPHLYNIVRAVFGLGVVE
TEVFNTSVKDIKEQVRLLNTHLQGKSYLVGDRLTVADVVVAVALLFPFQLVLDGGFRKSV
APNVTAWLERFVALPEVVRRLGHVKFCAKPHKAVAPPKKEEEKKPAAAAAKKEVTEDNLM
KKEVDPLDELPPSKLDLNAFKNYYVNLPKEQQKTEGMDYFFQNYDAEGYSLYYAKYDKYE
GEGVVLYQTSNLMNGFLQRIDSFRRHTFAMMAIVGEVPNLDIESVWLFRGKGIPQQMIDH
PQFEYYQKRELNVNNEDDKKLIREFWSCKPGDIVNGRPVVECKMHK