Identifiers and Description

Gene Model Identifier

Contig19220.0.g56

Standard Name

EEF1Ba

Aliases

Contig19220_0_g56

Description

EF-1 guanine nucleotide exchange domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • eukaryotic translation elongation factor 1 complex (IEA) | GO:0005853

Molecular Function

Biological Process

Domains

  • ( pfam00736 ) EF-1 guanine nucleotide exchange domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008592607.996806159126539e-24EF-1 guanine nucleotide exchan
ge domain conta...
SGDYAL003W2.000769134519826e-18EFB1 SGDID:S000000003, Chr I f
rom 142174-142253,142620-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19220.0.g56(coding)
ATGGAGGCCGTAAACTTTGATCAATACGAAAAAACCCTTACTGAATAACAATTCCTCGGA
GGACAACTCCCAACTGCTGCTGACAAGGAAGCTCTCGAACTTATTAAGGGCAACGGTCCC
AACGTTGAGACCCACCCACACACCTTCGCCTGGTACTCTCTTGCTTCCAGATTCCACGAG
TCCGTAAGAAACTCATGGGCTGCCGCTGCCCCAGCCAAGGGTGCTGAGAAGAAAGCTGCT
CCCAAGAAGGAGGAGAAGAAGGAAGAAAAGCCCGCTGCTGATGAGGATGAATTAGATCTT
TTCGGAGACGGTCCAAGTGAGGAAGAACTCGCTCTCAACGCTTAAAAGAAGAAGGAAGCC
GAAGAAGCCAAGGCCCAAAAGGCTACTGGTGGCAAGCCAGGTGTCATCGCCAAGTCACTC
ATCTTGTTCGACGTCAAGCCATACGAAGCTGAGACTGACCTCGACCAACTCTTCGTTAAG
GTCATTGGCATCGAGATGGACGGTCTCCAATGGAAACAAGATAACAAGAAGGAACCAATT
GCCTACGGTGTCTGCAAACTCGTTGTTGGTTGTGTCATTGAAGACAACAAGGTCTCCGTT
GATGATCTCATTGATAAGATCATGGAATTCGAAGAAGAAGTCCAATCAGTCGATATCGCT
GTCTTCAACAAGATTTGA


>Contig19220.0.g56(protein)
MEAVNFDQYEKTLTEQQFLGGQLPTAADKEALELIKGNGPNVETHPHTFAWYSLASRFHE
SVRNSWAAAAPAKGAEKKAAPKKEEKKEEKPAADEDELDLFGDGPSEEELALNAQKKKEA
EEAKAQKATGGKPGVIAKSLILFDVKPYEAETDLDQLFVKVIGIEMDGLQWKQDNKKEPI
AYGVCKLVVGCVIEDNKVSVDDLIDKIMEFEEEVQSVDIAVFNKI