Identifiers and Description

Gene Model Identifier

Contig20475.0.g58

Standard Name

EEF1Ac

Aliases

Contig20475_0_g58

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam03143 ) Elongation factor Tu C-terminal domain
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam03205 ) Molybdopterin guanine dinucleotide synthesis protein B
  • ( pfam04111 ) Autophagy protein Apg6

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001286203.00004133315474e-119Elongation factor Tu C-termina
l domain contai...
SGDYPR080W4.9994004612166366e-86TEF1 SGDID:S000006284, Chr XVI
from 700594-701970, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20475.0.g58(coding)
ATGTCAAGACATAAAAACTTAAAGAGCATTGTAGCTGATAGCTACTATGATGAAGACTAC
TACAATGATTATGGAGCTGAATATGGTAATGAAGGTGGTGCTTATGGTTCGGAAGATGAA
CACAAAGAAGAGCAAAAATAAATACAAAAAGCTAAGAAAAAATCTAAGAAGTAGAATTTG
GTTGATGACAAAGTGGTGCAAGAGATATTCGACTAGTTCAACAAATTTTTTACTTAAGAG
CAAGTCAAACAAACTTTAATAGCCAATTATAATGACAAATTGAAGACTATCGCTGATTTA
AGATTTAAGGAAGATAAACTTAAGCAGAAGGGCAAAGAGAACTTAAAGCAAGTAATTCAA
GTGAAGAAGTAAAAAGTAGAGGAAGAGAAAAAGCAATTCCATGCAGAGGAAGAGGAATTC
AAGCAATATGAAGTTCAACTTTTAAAGAAGGAGAAAAGTCTTAATGCTGAAATCGAAATA
GATCATAAAACTCTAAATTAGATATATCCAGAAGTTTCATACGCAGATCCTTAATTTTTG
AAACACTTAGAGGAGGACAATAAAACCATAAATCTTGTTATTATTGGTCATGTCGACAGT
GGTAAAAGTACACTGACGGGACATTTATTGTATAAATTGGGGAAGGTTGATAGATAGACC
ATGCATAAGATGGAGAAAATTAGTGATTAATATGGAAAAAGCAGTTTTAAATTTGCATAT
TTACTTGATGAAGGAGAAGAAGAAAGAAGAAGAGGAGTTACCATATAGGTTGGTCAGAGT
TACTTTGCCACAGAAAATAAGGATTTCGTAATTTTGGATGCTCCAGGACATTAAGATTTT
GTTCCAAACATGATTAGTGGTGCTTCATAAGCAGATTGTGCTATTCTAGTAGTAGAAGGT
ATTAGACAAGAATTCTAGAGAGGATTTATAGGTGGTGCAACCAAAGAACATGCAATCTTA
GCAAGAAGTTTAGGTGTAACTTAAATGATAGTGGCAGTAAATAAATTAGACATGGTTGAA
TGGTCTTAAGAAGCTTATGATGAAATCGTTGCATAAGTTCAGCCATTCTTGATGTCAATT
GGATTTAGACAAGATAACATTACATTCATACCTATCAGTGGACTTCATGGAACAAACTTG
ATTGCAAAACCTAATGAAGTTCAAGAGTTAATAAGATGGTATGATGGCCCTACTCTAATT
GAATTGCTAGATAAATTAAAGATCCCAAAAAGAAACATAAGCAAGCCCTTAAGAGTCTGC
ATCTATGATTACTATAAAGGAACTGAAGGCAATTTAATAGGTGATTGTATTTCAGCAAAA
ATTGAATCAGGAATTGTCAAAGAAAAGGATCATCTTCTTCTGATGCCTCTTAATATTATG
GTTACAGTCAAAGCGATAGAAACTTCGGATAAAGTTATTAAATTTGCTGGTCCAGGAACA
CTATGTGATATGTCCCTTCACCTTCCTCCTTCCGTTGATCCTACTTATATTAAGTCTGGT
TAAGTAATTTGCGATCCTAAGTATCCAATCTATTAAGTTAAAGAGTTCAGGTGTTAAATT
GTTGTCTTTGATATTGATATACCTATCACTAGAGGACAACCAGTGACTGTTTATAGTTTC
TCAAATAGAATATCTGGTCGTATATCCAAACTAGAAAGCATAGTCAACCCTAAATCAGGC
GAAACAATCAAGAAAAACCCAAGATGCTTACTAAAGAATCAGACTGCAATTGTCCATGTT
AAACTGGAAGAGAAAACATGTTTAGAACTTTTTAGCAATTACAGATAACTGGGTAGAGCT
ACTTTCAGAGATGGACAGAAGACATTAGCGGCAGGTATTAACATAGAACTAGGGGGNCCC
TAGCCATTGATATTGTGA


>Contig20475.0.g58(protein)
MSRHKNLKSIVADSYYDEDYYNDYGAEYGNEGGAYGSEDEHKEEQKQIQKAKKKSKKQNL
VDDKVVQEIFDQFNKFFTQEQVKQTLIANYNDKLKTIADLRFKEDKLKQKGKENLKQVIQ
VKKQKVEEEKKQFHAEEEEFKQYEVQLLKKEKSLNAEIEIDHKTLNQIYPEVSYADPQFL
KHLEEDNKTINLVIIGHVDSGKSTLTGHLLYKLGKVDRQTMHKMEKISDQYGKSSFKFAY
LLDEGEEERRRGVTIQVGQSYFATENKDFVILDAPGHQDFVPNMISGASQADCAILVVEG
IRQEFQRGFIGGATKEHAILARSLGVTQMIVAVNKLDMVEWSQEAYDEIVAQVQPFLMSI
GFRQDNITFIPISGLHGTNLIAKPNEVQELIRWYDGPTLIELLDKLKIPKRNISKPLRVC
IYDYYKGTEGNLIGDCISAKIESGIVKEKDHLLLMPLNIMVTVKAIETSDKVIKFAGPGT
LCDMSLHLPPSVDPTYIKSGQVICDPKYPIYQVKEFRCQIVVFDIDIPITRGQPVTVYSF
SNRISGRISKLESIVNPKSGETIKKNPRCLLKNQTAIVHVKLEEKTCLELFSNYRQLGRA
TFRDGQKTLAAGINIELGXPQPLIL