Identifiers and Description

Gene Model Identifier

Contig727.1.g118

Standard Name

EEF1Ab

Aliases

Contig727_1_g118

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam03143 ) Elongation factor Tu C-terminal domain
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam08477 ) Miro-like protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006558209.997093137033517e-262translation elongation factor
EF-1, subunit a...
SGDYPR080W9.997093137033517e-262TEF1 SGDID:S000006284, Chr XVI
from 700594-701970, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig727.1.g118(coding)
ATGCCAAAGGAAAAGAACCATCTTAACCTCGTCGTTATCGGTCACGTCGACTCTGGAAAA
TCAACCTCAACTGGTCACTTGATCTTCAAGTGCGGTGGTATCGACAAGAGAACCATCGAA
AAGTTCGAAAAGGAAGCCGCCGAAATGGGAAAAGGTTCCTTCAAGTACGCCTGGGTTCTT
GATAAGCTTAAGGCCGAAAGAGAAAGAGGTATCACCATTGATATCGCTCTCTGGAAATTC
GAGACCGACAAGTCAGTCTTCACCATCATCGATGCCCCAGGTCACAGAGATTTCATCAAG
AACATGATTACTGGTACTTCTCAAGCTGATGCTGCCATTCTCATCATTGCCTCAGGTCAA
GGAGAATTCGAAGCTGGTATCTCAAAGGAGGGTCAAACCAGAGAGCACGCTCTCCTCGCC
TTCACCATGGGAGTCAAGCAAATGATCGTTGCCATCAACAAGATGGACGACAAGTCAGTC
AACTGGTCAGAAGAGAGATTCAACGAAATCAAGAAGGAAATGTCCGACTATCTTAAGAAG
ATTGGTTACAACCCAGACAAGATTCCATTCATCCCCATCTCAGGTTGGTTCGGTGATAAC
ATGATCGAATCATCAGACAACATGAAATGGTACAAGGGTAACACCCTCATCCAAGCCCTT
GATGCTCTTGATCAACCAAAGAGACCCAAGGATAAGCCACTCAGACTCCCACTCCAAGAC
GTCTACAAGATCGGTGGTATCGGAACTGTCCCAGTCGGCAGAGTCGAGACCGGTCTCCTC
AAGCCAGGTATGGTTTTGACCTTCGCTCCCATGACCATCGTCACCGAGTGCAAATCAGTC
GAAATGCATCACGAGTCCCTCGTCGAAGCCGAGCCCGGTGATAATGTTGGTTTCAACGTT
TACCTCTCAGTCAAGGATCTCAGAAGAGGTTTCGTCGCTTCAGACACCAAGAACGACCCA
GCCAAGGATACCGCCTCTTTCCTCGCTCAAGTCATCGTTCTTAACCATCCAGGTCAAATC
CAAAAGGGTTACGCTCCAGTCCTCGATTGCCACACTGCCCATATTGCCTGCAAATTCGAC
GAAATCGAATCCAAGGTCGACAGAAGATCTGGTAAGGTCCTCGAAGAAGAGCCAAAGTAC
ATCAAGTCCGGTGATGCCGCTATGGTCAGAATGGTCCCACAAAAGCCAATGTGCGTTGAA
GCTTTCCAACAATACCCACCACTCGGAAGATTCGCCGTCAGAGACATGAAGCAAACCGTT
GCCGTCGGAGTCATCAAGGAAGTCGCAAAGAAAGAGCAAACCGGTAAAGTCACCAAGGCC
GCCGCCAAGAAGAAGTGA


>Contig727.1.g118(protein)
MPKEKNHLNLVVIGHVDSGKSTSTGHLIFKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDIALWKFETDKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASGQ
GEFEAGISKEGQTREHALLAFTMGVKQMIVAINKMDDKSVNWSEERFNEIKKEMSDYLKK
IGYNPDKIPFIPISGWFGDNMIESSDNMKWYKGNTLIQALDALDQPKRPKDKPLRLPLQD
VYKIGGIGTVPVGRVETGLLKPGMVLTFAPMTIVTECKSVEMHHESLVEAEPGDNVGFNV
YLSVKDLRRGFVASDTKNDPAKDTASFLAQVIVLNHPGQIQKGYAPVLDCHTAHIACKFD
EIESKVDRRSGKVLEEEPKYIKSGDAAMVRMVPQKPMCVEAFQQYPPLGRFAVRDMKQTV
AVGVIKEVAKKEQTGKVTKAAAKKK