Identifiers and Description

Gene Model Identifier

Contig14463.0.g78

Standard Name

EDT5

Aliases

Contig14463_0_g78

Description

Eukaryotic DNA topoisomerase I, DNA binding fragment

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam02919 ) Eukaryotic DNA topoisomerase I, DNA binding fragment

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14463.0.g78(coding)
ATGAACAAATTGCAATCTAAGCTCACTTTAAAATAGAGCTAACAGACTATTATGCAAAGC
AATTAAGATATCACCAATACTTAATTAGGAGCAGGTGGACTATCTATTTCTTAAAACTAG
AGCTAAGTTAAAATAGACAAAGATCAAGATAGAGTACATAGCATGTATAAAAATGTTCTG
TAATCAGAGTTTCATAGGGAAAAGGGCCTAATGAGTAATTGTATAGAGTAAGCAAAGAAC
TAAAGTTAAAAGAAGGAAAGTGAGCTTTAAACATTAAGAGACGAAAATAGGAATCTTAAG
TAGTAGTTCAAAAGAGTCAAAGAGATGATAGATTAGTAAAATTCACGCACAAGTACCAAT
TCTAGAGGAAATATGATCTTTAACGATAGCGCTACTGTAACAAGTTATGATAACTAGAGC
TATGTTGCGAGCAAAAAAGGTTTTGGGAAAAGTAGTTAGTTTATGTCTAATACATAACTT
CTAAACGTTATGAAACCTTTATCAAATTTTGGCAAACCAGGACAGTAACAATTTACCGAC
ATCATTAAGTTTGAGAAATTTACCATGTGTCTATAAAATCTATTTAAAATAGAGAGGTCT
TTCGATTTCATCTTGACTTTCCTAGAGTAAGAAAATTCATGTTTTAATACTATTTGTAGT
GAAGTGAAAAACATTTTTGAATGCCAAAAAGCAACACTATTTGTTATATCTAAGAATTTC
TATAAATCCCTCATAGAGGGTGTTAAAAAAGAAAAATCAAAGTATATACACTCAATAGAT
TATTATGATTCACAAAGTATTGAGAAGACTTAACTCATTGCAATAGCTAGAACTGAAAAA
GAGCTTTGTGATAAACTTCTATTCCCTAGTATATTATAAGTCAAAAGAGAAGCTATTAGA
AAGGGAGATTCCATGTGCATCTGTGTAAGATATCACAAGAGTGACGGTGAGCTATGTCAT
ATTTTACAAATAGAATACGAAAGTAAAACTAAAGAAAACGGTTTAAATGAGTAAAAATCT
TAAAGCCTTAACAGAACATAGCCAATTAAATCAAACAAGAAGGGGTTCAGTCATAGTGAT
GAAGTCACTTTTAGAATCATAAGTTAATTCTTGTAATTACGACTAGAGAAGCACATGCTT
TATAAGGATGTCAAATAGAAGATACAAGATCGTTAAGAAGCTATATAAATGGCAAATAGA
ATTTGTAAATTAAAAACTTATAAAGCTTTAATGAAGGGCATGCACAGAGAACTCATTTAG
TTTTTATCATTTAAAGAGTGTGGTATCATGTTCTATGATGCTGAGAAGCAAAAATTGTTT
ACAATTTCTATAGACTAAGATGAAGATTAGAAACTTGGTGACTCTAGTTTTAAAGGATAG
CAAAATTTAGACAAAGAATTGAAACAGGATATTACTGATCTAACTTTAACTGAAAAGCAA
TTGATATGGTTTCCATGCAGTATGGGACAAACAGGCTATGCTTTCAAAAATAACACTTAC
CTTGTCTAAAATGATGGCAAGAAGCGATTCATCAACATACCTCAAATCGGATATCAAAAT
AATGGAGAACCCTTACCTCCTGTAAATGTTGAGTTTATGAGCGACATAGATAACTCAAAA
GGTGTAAGAAACTTAGAAAACTACTTGATTGGATCTTTGCAAGGAGGAGAAAATTAGCAA
GCCAACGGAATCATATAGATGTTCAATTTTAAAAGTGCAATTTCTAAAATCTAGATTCGA
AGATATGATGCAATATCTGGGTTTTTGGGAGGTTGTCTAGCCAACATAGCTGACATATCA
AGAAGTATTACTACTATGATTGGAATATAAATGGTCATTGATAATTGTTCAGAGAGTGCA
AATTAAGCAGAGATCAGAGTAGAGTAGAATTTGGCTGAAATAAGATCAATTATTGTTCCA
ATTGATACAGTCAAAAAGTTGACTGAATATTTGGAATAGGTTCATACTTAAAATAATGAG
ACTAAAACAAAGAAAAGCTCAATAAAATTGTGA


>Contig14463.0.g78(protein)
MNKLQSKLTLKQSQQTIMQSNQDITNTQLGAGGLSISQNQSQVKIDKDQDRVHSMYKNVL
QSEFHREKGLMSNCIEQAKNQSQKKESELQTLRDENRNLKQQFKRVKEMIDQQNSRTSTN
SRGNMIFNDSATVTSYDNQSYVASKKGFGKSSQFMSNTQLLNVMKPLSNFGKPGQQQFTD
IIKFEKFTMCLQNLFKIERSFDFILTFLEQENSCFNTICSEVKNIFECQKATLFVISKNF
YKSLIEGVKKEKSKYIHSIDYYDSQSIEKTQLIAIARTEKELCDKLLFPSILQVKREAIR
KGDSMCICVRYHKSDGELCHILQIEYESKTKENGLNEQKSQSLNRTQPIKSNKKGFSHSD
EVTFRIISQFLQLRLEKHMLYKDVKQKIQDRQEAIQMANRICKLKTYKALMKGMHRELIQ
FLSFKECGIMFYDAEKQKLFTISIDQDEDQKLGDSSFKGQQNLDKELKQDITDLTLTEKQ
LIWFPCSMGQTGYAFKNNTYLVQNDGKKRFINIPQIGYQNNGEPLPPVNVEFMSDIDNSK
GVRNLENYLIGSLQGGENQQANGIIQMFNFKSAISKIQIRRYDAISGFLGGCLANIADIS
RSITTMIGIQMVIDNCSESANQAEIRVEQNLAEIRSIIVPIDTVKKLTEYLEQVHTQNNE
TKTKKSSIKL