Identifiers and Description

Gene Model Identifier

Contig9571.0.g58

Standard Name

EDT3

Aliases

Contig9571_0_g58

Description

DNA topoisomerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002161402.000043494209831e-96DNA topoisomerase family prote
in
SGDYLR234W8.00275873087502e-68TOP3 SGDID:S000004224, Chr XII
from 609783-611753, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9571.0.g58(coding)
ATGCTTGATATGATAGTAACTTCAGTATGTGGGCATATAATAGAATATAAGTTTCCATAA
AAATGTAAAGATTGGGCCAAGACCCCTTACAAAGAATTATACAAATGCAAATTAGAGAAA
CAGCCATCTGTCTAGAATCTAGATATTGTGAAAAATTTGCATGAATATGCTAAGAATGCA
GATATGCTTATCCTCTGGTTAGATTGTGACAGAGAGGGTGAAGCTATAGCTTTTGAAGTA
ATTGAAATAGTAAGAGAGATCAAACCAGACATAGAGATAAAAAGAGCGCATTTCTCAGCT
TTAACTAAACAAGACATTTTCAGAGCGATCACTACTAGACTAACTGAACCAAATAAGAAT
TAAGCAGATGCAGTTTTTGCAAGATAAGAAATAGATCTTAGGATTGGGGCTAGTTTCACA
AGACTTCAATCTATGAAGTTTAAGGATGTCATAGGAGCAAATTAGAAGTAAGTTTTAAGT
TATGGACCTTGCCAATTTCCAACTCTCGGATTTGTGGTCGAGAGGTTTACTAAAGTTTCT
AAGTTTGAGCCTGAAAAGTATTGGACTATCACTATATAATGCCTTAAACCTCAAGAAATA
TTGGAGGAAGAGGCATAAGAGGAGGAAAATTAGGAAGATCAGGAAGAGTATGGAGAAGAA
GTAGATTAAGAAAATTGTAATGCAGATATTCAATAAGAGCAAAATACTGAAGAATTGGAT
CCAAGCCAAAATTAAGTAACTGATACATAACTTTACGATAACACGCAAGCATAAGATACT
TAAATGCATAATGTTGAAGAAAACAATGATGGTTATGAGAATGAAGATGATGAAACTGTA
GAATCCCCAATTCAATAAATTTCAGTTAAAGAAAATTTAGTAGAACAAAAAGATAACATG
TAATATGATAATAAGATTTGTGAAAAGGATCTGAATAATTTTTCAGAAGAGTTTGCAACT
GACGAATAAAATAGTTAAAAGGATTAATGCTAATAAAATATTGATACAACTTAAAATAAA
CCTCAGATTTCTGAACCAACACCTGAGCCAGAGGTAAAACCAAAAAGGAGAGGATTCTTT
GAATCAAAGAAACCAAAAGATGCTATTTAATTTGATTGGGCCAGATACCGAATCTTTGAC
CAGTAAATGTGCGAAATCCTCTTAGAAAACATTTAAGATGGCGAGGTTGCTACTGTAACA
AAAGTAATTTCAAAAAGGAAAACTAAAATTAAGCCTATACCTCTAAACACTATAGACTTC
CAAAAGCTAGTTTCTAGAAAACTAAGAATAGGGTCTCATAAAGCTATGGAAATTGCTGAG
AAATTATATCAAAGAGGCTATATTTCTTATCCAAGAACAGAAACGAACATTTTCCCAGCT
ATGAACTTATAAGAAATTGTGAAAGATCTTACAAAGAATACAACATTTGGAGGATATGCT
AAGAAAATTTTGAGTGGGAACTTATATGGAACTCCAAGAAAAGGTAAGCAAGATGATAAA
GCTCATCCACCTATCCACCCAGTCAAGAATGCAAATAAAATGGACTTAAAGCATGATGAA
TGGAGAATATATGAAATCATATGCAAACACTTCCTGGCTTGTTTATCTAAAGATGCAACT
GGCAATGAAACTAAAATTGAAGTTGAAATTGGTGGAGAGACATTCAAGACTAGAGGATTA
GTAATAGTAGAAAGTAACTGGCTTGAAATTTACTAACCTTATGAGAAATGGGCTGATAAT
ACTTTACCAAACTTTCAAGAAGGAGATTAGTTCACTCCATCATTAATCCAAATGCAGGAA
TCTTAAACTCAACCACCAAAGTTACTAAGCGAGGCAGATCTCATCAGTAGAATGGATAAA
AATGGAATTGGTACAGATGCTACGATTCATGAACACATTAAAACAATTCAAGATCGAGGT
TATGCTTTGAAGCAAGGTTAACATTTTATTCCTACATAACTTGGGTTAAATCTTGTTAAT
GCTTATGATCATGTTGGTATCGAACTCTTCAAACCAAACTTGAGATCATAAGTTGAGAGA
CAATTAAAGGAAATTGAATATGGAAATCGAAATAAGAAAGAAGTTCTAAAAGAATGTTTG
AGAGAAATGCGAAGAATTTTTAAAACCGTGAAAAGTAGGTCTGAGGAGATGCAAGATTTC
TTAACTTAGTAAATTATAAACCCAATAATTTAAGTTCCTTCACTGATTAAAGATCAATCT
GAATCAGACTCTCAACTATAAAGCTCGAATGCCTAAATGACTTAACTCTTAAATAATTAT
GATGTCAAGGCAGAAGACTTTTTTAAGACTCCAGTAGAAATTCAAAAGAAAATTAACCAT
GAAAAGAAATTTTCTTAAGATACAGTATTTAACAGTGATGAAAAAACTACTCTAGCAGAT
ACTCAGTTCATGCTATGTGATAAGTGTAGATAAAACCCAGTCTATATTAAAATGGCAAAC
TCTGGATTTTTATTTGCAACTTGTGCTGGCTATCCCAAATGTAAAAATTCTTAGTTTTTA
CCCAAGAATGTCAAAAATCTTGCAGTAACAGATGAAAATTGCCCTGCTTGCACAGAGGCA
AGAGAGAACGAAGAGGTTAAAAAATTAAAAATATCTTTCTATACAAGCTGTGCTTAAAAT
TAAGAAGAATTGTAATAAGCAATATAAAATTCACAATCAATTTATTGTATCCTTGGTACC
TGTGATGAAAACTTCTAAAAAGTAAAGTAATTTTGTAAGGGGATTAAAATCCCGCCAAAG
AAAGGAACTTTTCTTGATGAGTTGACTGAAGAGGAAAGATAAGCTAAAATTGAGTAGAAT
CAACGTTGGTTCGAAAGACGTCGAGATTTTAAAAGTTTTGGTAAAAATAATTATTAAAAA
GGACAACAAACTCTTGGAGGTGATAAAGGGTTTGTATAGAATGGAAGTGGAAGATTTAAG
AAAGGTAGTCATGGATTTGAAAATCAAAATGGTAAAGGAATGAAAGGTCAAAAAGGAGGA
GGTAGAAAATAAAAGGGCGGTGGATGCCCTGAATGCGGGAAGAAAAGACATTCAGCAAAA
AGCGATTGCATCAACAATAAAAATAGAAATCAGATTGAATGA


>Contig9571.0.g58(protein)
MLDMIVTSVCGHIIEYKFPQKCKDWAKTPYKELYKCKLEKQPSVQNLDIVKNLHEYAKNA
DMLILWLDCDREGEAIAFEVIEIVREIKPDIEIKRAHFSALTKQDIFRAITTRLTEPNKN
QADAVFARQEIDLRIGASFTRLQSMKFKDVIGANQKQVLSYGPCQFPTLGFVVERFTKVS
KFEPEKYWTITIQCLKPQEILEEEAQEEENQEDQEEYGEEVDQENCNADIQQEQNTEELD
PSQNQVTDTQLYDNTQAQDTQMHNVEENNDGYENEDDETVESPIQQISVKENLVEQKDNM
QYDNKICEKDLNNFSEEFATDEQNSQKDQCQQNIDTTQNKPQISEPTPEPEVKPKRRGFF
ESKKPKDAIQFDWARYRIFDQQMCEILLENIQDGEVATVTKVISKRKTKIKPIPLNTIDF
QKLVSRKLRIGSHKAMEIAEKLYQRGYISYPRTETNIFPAMNLQEIVKDLTKNTTFGGYA
KKILSGNLYGTPRKGKQDDKAHPPIHPVKNANKMDLKHDEWRIYEIICKHFLACLSKDAT
GNETKIEVEIGGETFKTRGLVIVESNWLEIYQPYEKWADNTLPNFQEGDQFTPSLIQMQE
SQTQPPKLLSEADLISRMDKNGIGTDATIHEHIKTIQDRGYALKQGQHFIPTQLGLNLVN
AYDHVGIELFKPNLRSQVERQLKEIEYGNRNKKEVLKECLREMRRIFKTVKSRSEEMQDF
LTQQIINPIIQVPSLIKDQSESDSQLQSSNAQMTQLLNNYDVKAEDFFKTPVEIQKKINH
EKKFSQDTVFNSDEKTTLADTQFMLCDKCRQNPVYIKMANSGFLFATCAGYPKCKNSQFL
PKNVKNLAVTDENCPACTEARENEEVKKLKISFYTSCAQNQEELQQAIQNSQSIYCILGT
CDENFQKVKQFCKGIKIPPKKGTFLDELTEEERQAKIEQNQRWFERRRDFKSFGKNNYQK
GQQTLGGDKGFVQNGSGRFKKGSHGFENQNGKGMKGQKGGGRKQKGGGCPECGKKRHSAK
SDCINNKNRNQIE