Identifiers and Description

Gene Model Identifier

Contig17613.0.g83

Standard Name

EDT2

Aliases

Contig17613_0_g83

Description

Eukaryotic DNA topoisomerase I, DNA binding fragment

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02919 ) Eukaryotic DNA topoisomerase I, DNA binding fragment

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17613.0.g83(coding)
ATGAGTTAACCATACGGTGGAATTAAAAGGTCTTATGCCAATCAATCAGCTAGTTTAACT
GGGATTCCAGGAGGATACGATGGTTTAAGATCTAGTCTTAGAGGGGCAAGAGATACCATG
AATGTGGACGATATCGAGGGTGCAGTTCCAAGGAGATTAGTAGGGTACACTGGAGCTAGA
CCAGACGTTCTTTTGTAAAAAGAGCAAGCTCAATTTGATTAATATGAGTAGACTCATAAA
CTCAACTTGGGATAATCCTTAACTAATAATGCTAATCAGTTTTTACCAGCAGGTTATAGA
TAACTCTAGGGAGGTTTAGAGATAGGCTAAGGTAGTGGTCCTGAACACTTTAAATCATAT
GAATAGAGATTGCTTAGAACCGACGATATAACTGGAGCAAGGCCTAAACATTATGGAATT
AACATACCTTAAGGCACTTTTGCGGGTAACACAAGTGGGAATTTGAAGACCTATAAAAAT
GAATCTACTGACATTCTAAATTAACAGAAACTATAACATGATTAAAGTTAAGCTCACTTA
TCCACTGCTTAAACTTTGAATAAAAACACTCTCGGTACTACTTCATAACATAGATTCGCT
TAACTTAACGTTCCTTAAACCATTACCAAGCCATTTAACCCCTAATTTTAAACTTCATAC
ACAGCAAATTACTCACCTCTGCGCAGTGATAACATAAAAACTTTGTAATTGGCTAAACCA
TTAGCTATTGATACAAATCTTATGTTTAGAGGGCATGCAGATATCAGTGGGGGTCTCAGT
GGATATGCAGGAGTTGGCAATTTGGCATCTAGTTTCAAGACAAACTACTAGTAGAATTAT
AACTTCGTGAACGACTATTAGAAGTAAATGGATAAGTAAAATCAACGAAGGTACTAAGAA
AATGTTGATAAAATGGACAAAGATAGAATCGAAAAGATGGTTAGAGAAAGTTCACCTTAA
CTTAGTAGATTGACTGATTACAAGAGAGATTAGCAGGCAGCTCCATAAATATAGAATTAA
AAAATTGAACTCCCTGAATACATGAGGGATTATGGAATGCAAAATAATTACGAAACTGAT
AGATAGAAACTTGAGTCAAGATCTAAGCAAGGAAATGATTATAATACAAATTAATCTCAG
GTTTCTGGTATTGATTACAATATAATTCCTTAAGAATTCAGAAACTAGCTGCAATCTGAT
ATGATTGATAGAAATTAATAGTAATACGATTCCCAACCTCCCAGCTAAAATGGGGATGCT
TTAGGTGCCTCCCTTAGACATGACCCATCAAAACAATCTCTTCTAAGAAGTTCACTTCAA
TAAAACGCAGAGAGTATAATTCATGGAGACAAATCTATGGCTGGAATAAATTCTTAAGCA
GCTCCTCTCTCAATGAAAGATCAAAACACTTACATGAGACATCAGCAAGATTAAGATATT
TCTATTCAGAAAAAGATTCCTGGTTAAGATAGGTACTAAACCATTTAAAATCATGCATTA
AACGACATGGAAAAATCTTACAAATATCTGTCTATGGCACCTACCACAGATCAAGGCAGA
GGTCATGAATTTATTGATCACAACATTCAAAATAGAGAGTCGCTTAAAATCGGCAACAAG
AATTCTGGAGTTTCTTATGAGGATCTTATGCCAAAGCTTAACGACATTAACTTTCATAGA
TCATCCCAAAGAGCAAAGAATAATTTCAATGTATTAACAGGTACATATAAAAAGTTAGAA
TGA


>Contig17613.0.g83(protein)
MSQPYGGIKRSYANQSASLTGIPGGYDGLRSSLRGARDTMNVDDIEGAVPRRLVGYTGAR
PDVLLQKEQAQFDQYEQTHKLNLGQSLTNNANQFLPAGYRQLQGGLEIGQGSGPEHFKSY
EQRLLRTDDITGARPKHYGINIPQGTFAGNTSGNLKTYKNESTDILNQQKLQHDQSQAHL
STAQTLNKNTLGTTSQHRFAQLNVPQTITKPFNPQFQTSYTANYSPLRSDNIKTLQLAKP
LAIDTNLMFRGHADISGGLSGYAGVGNLASSFKTNYQQNYNFVNDYQKQMDKQNQRRYQE
NVDKMDKDRIEKMVRESSPQLSRLTDYKRDQQAAPQIQNQKIELPEYMRDYGMQNNYETD
RQKLESRSKQGNDYNTNQSQVSGIDYNIIPQEFRNQLQSDMIDRNQQQYDSQPPSQNGDA
LGASLRHDPSKQSLLRSSLQQNAESIIHGDKSMAGINSQAAPLSMKDQNTYMRHQQDQDI
SIQKKIPGQDRYQTIQNHALNDMEKSYKYLSMAPTTDQGRGHEFIDHNIQNRESLKIGNK
NSGVSYEDLMPKLNDINFHRSSQRAKNNFNVLTGTYKKLE