Identifiers and Description

Gene Model Identifier

Contig9238.0.0.g6

Standard Name

EDT1

Aliases

Contig9238_0_0_g6

Description

Eukaryotic DNA topoisomerase I, catalytic core

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01028 ) Eukaryotic DNA topoisomerase I, catalytic core

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9238.0.0.g6(coding)
ATGAACGGCAGCGAGAATATTGCTGAAAACAAATCTAAAAACGAGAAAATAAAGCGTCTG
AGGCCCAGAGAGGTCAGAAGACGTCAGAAAGAATTGCATAAACTCTAATAAGAAGATCCC
ATTTATATCGACTATGCAAAGCCATTCTCTGCCACTCCTTACTATGATTACTTTGATAAC
TTTGTTTTGGGTTTCAAAATAGAGACTGATGTGCCCACCTCCGCAGACTGCATTGATTCT
CTCGTGTACTCCCTCGACGATTGGACCTATTTCCAAAACAACATCACAGACCTAAGTTCA
TGGGAATCACCTATTCTCAATTTCACCCGTGCTATTGGAGGAAACCTCTCAACTGTCCCC
ATCAATTGTAAGCTTTTTGGTGATGAATACGTGACTTACACTATCGACAAGTACTCTGGC
TTCAACAATAAAATAGGAGATATTATCCTCGCCTTCGTTTTCAATATTATGGGTAACTCC
TTGAAATTTAAACAAGCTATGGATGACATCAATAACGATTTTAAGAATCAATTTTACACA
GATATCGCTCAACAGTATGGAAAAATTCTAAGATTGACACTTGACTTCAGCGCTGATGAT
CTGTCCGCAGCCTCCCTATCCTCATCTGAGGAGCAGATGCGTTAAATTCAAACTGACAAC
CCAGTTTTTCAATACATTTTAAATAATGTGAACAATGAGACTGTCCAGCCTGTTGCTCGC
AAAATCGAGCAATTCATTGATCACGCTAAAGAGATGAAGAGAGTATATGCTTAAGGTGGT
CTTATGAGTCTTTTTGACAAGGAAGTTTCAAATTTGATAAGATCTTTTGCTGGTGAAGAC
GCTGTTTAAATTTTTGATTAGCTAAATACTTCTGAGTTGAATGAAATGCTTGCAACATTC
ACTGGTGTTTCAGACGCTTACAGTTTTGGAAGCGGATTCGTGAATGGCATGATCAATGTG
CTCCCAACTTAAAGTTTCTTGAGATACTGCAGAGACAATGTGACTTTGATTAATACTGAG
CAAACCAAGTTCAAAACTTATTGGGGTAGCGATTACAATTTGGCTTTGACCAGTTTCCAG
TTGATGCTTGAGGGTTTTGGAGAGTCGTCTTTCAACTGTTTCTACTCAGTCAAGGATCCC
ACTGCTTCTGGCTAAACCTCTGGAACTGGCTTAAAGTATATTGGTTGGAATGTTCTCTAC
AATTTGGGTTACATGTACACTGACGTTAGAAACTCAGTCACCATTTTCTAATCTACCACG
GAAAATTGGGAAAAACTTGGAAAATATATTGGAGATTTCTTGATTAGATTTGTCTACAGT
AGATATAAGCCCAAGACCACATGA


>Contig9238.0.0.g6(protein)
MNGSENIAENKSKNEKIKRLRPREVRRRQKELHKLQQEDPIYIDYAKPFSATPYYDYFDN
FVLGFKIETDVPTSADCIDSLVYSLDDWTYFQNNITDLSSWESPILNFTRAIGGNLSTVP
INCKLFGDEYVTYTIDKYSGFNNKIGDIILAFVFNIMGNSLKFKQAMDDINNDFKNQFYT
DIAQQYGKILRLTLDFSADDLSAASLSSSEEQMRQIQTDNPVFQYILNNVNNETVQPVAR
KIEQFIDHAKEMKRVYAQGGLMSLFDKEVSNLIRSFAGEDAVQIFDQLNTSELNEMLATF
TGVSDAYSFGSGFVNGMINVLPTQSFLRYCRDNVTLINTEQTKFKTYWGSDYNLALTSFQ
LMLEGFGESSFNCFYSVKDPTASGQTSGTGLKYIGWNVLYNLGYMYTDVRNSVTIFQSTT
ENWEKLGKYIGDFLIRFVYSRYKPKTT