Identifiers and Description

Gene Model Identifier

Contig13057.0.g50

Standard Name

EBP2

Aliases

Contig13057_0_g50

Description

Eukaryotic rRNA processing protein EBP2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam05890 ) Eukaryotic rRNA processing protein EBP2
  • ( pfam10932 ) Protein of unknown function (DUF2783)
  • ( pfam11157 ) Protein of unknown function (DUF2937)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004977901.9991517704232713e-32S-antigen protein
SGDYKL172W3.001003044337619e-17EBP2 SGDID:S000001655, Chr XI
from 125759-127042, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13057.0.g50(coding)
ATGGGAAAGTAATCAAAGCATATTTAATAAAAGCAGTCAAGGCTTTTCTCTGACAGCGAA
TCAGACAATTAGAGTGACTCTGAGGTGCCTCAACTCATCCCCGCCCCTGTGGTTTCAAAG
AATAAGTAAACCAAGTCTAAAGTCCCTTAGGTTTCATAAAATATCAAGGCAAAACCAGCA
TCTGTAAACAAAAACTACAAAGTTGAAGAATCCGACATGGAAGATGACGATGACCAAAGT
CACTCCTATGAAGAGGTGGACAGTGATAAAGAAATCGCACAAGCTTTTAACGGGGATATG
TCAGATTAAGAGCAGCCATTTGACTAGGAAAAGAATAAGTTGTTTGCCCAGAGAGGTATT
AATAATGAGGAGATGATGTTGAAAAGACTCAGTGAAATGAGAGCTAATTTCTATAATAGA
CTCGAGTCCAAGAGAATCATTAAGAAGCAAGGTAGAATCCCCTTCACAGAGCACATGACC
ATAACTAATGATGAGGTTATGAAAGTGCCAGAGGCTTTAACAGTACATGACGATATCAAA
AGAGAAATGGCATTCTATAACATGACTAGAGAGAATGTCAAGAAAGCAATGGAAATTCTA
ATTCAAGCCAAGGTTCCAATTAGTAGACCAGATGATTTCTTTGCTGAGATGTTGAAGACA
GACCATCATATGTCCAAGGTAAAGAGCAAGCTACTTTAACAGCAACATAAAATCGAAAAC
TTCGAAGAGCGCAAATAAAAGATGGAAAATAAAAAGTTCCATAAAGCAATCAAGGCCTAT
AAGCAAGACGTTAAGCATAAGGAGAAGAGACAAAATCTTGAAAATATCACAAAGCTTAAG
AAAGAGATTAGAGAAAAGGGTGGAGATACTGACGAGAAGGATTTCAACAAATTATTCAAT
GGAGGAGTTAACAAAGATATCAAGAAAGGACAGAAGTAGAGAGTGTTCGATGCAATTAGG
AGCAAAAGCAGTGATTCATCCAAAAAGGAGTCACAGGGAAGAAATAAAAAGAGCAAGGGC
ATCTCCAAAAATCAAAAGAGACCAGGCAAAGTCAATCGTAGCAAGCACAAGCCAAGAAAC
AAGAAAGCCAAGTGA


>Contig13057.0.g50(protein)
MGKQSKHIQQKQSRLFSDSESDNQSDSEVPQLIPAPVVSKNKQTKSKVPQVSQNIKAKPA
SVNKNYKVEESDMEDDDDQSHSYEEVDSDKEIAQAFNGDMSDQEQPFDQEKNKLFAQRGI
NNEEMMLKRLSEMRANFYNRLESKRIIKKQGRIPFTEHMTITNDEVMKVPEALTVHDDIK
REMAFYNMTRENVKKAMEILIQAKVPISRPDDFFAEMLKTDHHMSKVKSKLLQQQHKIEN
FEERKQKMENKKFHKAIKAYKQDVKHKEKRQNLENITKLKKEIREKGGDTDEKDFNKLFN
GGVNKDIKKGQKQRVFDAIRSKSSDSSKKESQGRNKKSKGISKNQKRPGKVNRSKHKPRN
KKAK