Identifiers and Description

Gene Model Identifier

Contig17568.0.g76

Standard Name

EARS2

Aliases

Contig17568_0_g76

Description

tRNA synthetases class I (E and Q), catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00749 ) tRNA synthetases class I (E and Q), catalytic domain
  • ( pfam01921 ) tRNA synthetases class I (K)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004718402.0003615238957836e-139glutamyl-tRNA synthetase famil
y protein
SGDYOL033W6.002904662242373e-91MSE1 SGDID:S000005393, Chr XV
from 263475-265085, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17568.0.g76(coding)
ATGAGGGAGGAAATCTAGCAATATAATAGAGAACTATCTTCAAGTTTCGATCAATAGTAT
TCAACTAGTGAATCACGAAGAGAAGTAAGAGTGAGGTATGCTCCTAGTCCTACAGGAGAA
CTTCACATTGGAGGACTGAGGACAGCTTTGTATAATTATTTGTTTGCTAAAATACATAAA
GGCAAGTTCATACTCAGAATTGAAGACACTGATAAGACAAGAGAAGTTCCTGGTGCAGTT
GACCGCTTGGCTGATATGTTAAGTTGGAGTGGTTTAGAATGGGATGAAGGCCCTATGTCT
ATATATAGCCTTAACAATCCTGGTTAAGATGGACCTGAAGGCCCCTATATACAATCACAG
AGGCTATAGCACTATTCAAAATATGCCAACGCACTTCTGGAAAATAAAGATGCTTATCAC
TGTTTCTGCACAGCAGATAGGTTGAAATAACTCAGAGTTGAATAGGGAGGGGAGAAACAT
CAAGCTACTAAATATGACAGATTCTGCTTGAATCTTAGCAAGAGTGAAGTAGAAGAAAGA
ATTGAAAAAGGAGATCCTTATGTTATCAGAATGCATGTCCCTCATGGACAAACTGAATTT
AAGGATATTATTCATGGAAAAGTTATTTTCAATCACAACGTCATTGATGATTAAGTATTA
CTTAAATCCGATGGATATCCCACTTATCATTTAGCAAACGTTGTAGATGACCACATGATG
AAGATATCACATGAATGGCTTTCATCTACACCTAAGCATTTGATGCTTTATAAAATGCTA
CAATTAGACGCACCTGAGTACGCTCATTTACCATTACTACTGAACGACAAAGGTCAAAAG
CTTTCAAAGAGATTTGGAGATGTCTCTGTCCAATAATATAAAGACAAAGGATTTCTACCA
GAAGCAATGATAAACGGTTTGGCTTTGCTTGGCTGGAATCCACCTCACAGAGAAGATCCC
GATGTCCTCTCACAAAATACTTCAGTATTTCTAAAGCATGAAGTAATGAACATGAAGGAC
TTAGTTGCAACTTTTGATCTTGATAAAGTTGGAAAATCTGGAGTTAAATTTGGCTAAGAC
AAGTTAGAGTTCTTAAATTCAATGCATATAAGAAATAAATTTGAATACTTTGATCAGTTA
GAAGCTAAAAAGGCCACAAACTCCTGGAGAAAAATGTTGTTAGATAATCTACCTGCAAAT
TTGCACCCACATATCAAGAGAGTGAATGAAAATAAAATGAAAAAGATTATGGATTTGATG
AAAATAAGAATACATTTCTTCCACGACATGTGCAATCACACCTACTTCTTTACTGAACCA
GACTATGAAAATATTATGTCTGAAAAGTTTGCTAAAAAGCTGAGGCAGCCACATGATGTT
AAACTAAAGATCTTAAAAGAACTTAAAACTAAAATTGGGAAAATAGATGATGATGAATTC
AGTCCAGATCGAGTAAACAAAGAATGCTCTATATATCTTTATGAAAATCAAAAATCAGGC
TATAAGAACGAAGACGTTTTCTTCTTGTTGAGATATTCAATGACTGGCAACCCAGTGGGA
GCCCCAGTTGGAGATATCTTAGAAATTATTGGGAAGTAAAGTGTGATGAAAAGATTTGAT
TTGGTGATCGAACACATTTAGAATTAGATCAAATTGGAATAAGACAAAAATTCAGCAAGT
GATTGA


>Contig17568.0.g76(protein)
MREEIQQYNRELSSSFDQQYSTSESRREVRVRYAPSPTGELHIGGLRTALYNYLFAKIHK
GKFILRIEDTDKTREVPGAVDRLADMLSWSGLEWDEGPMSIYSLNNPGQDGPEGPYIQSQ
RLQHYSKYANALLENKDAYHCFCTADRLKQLRVEQGGEKHQATKYDRFCLNLSKSEVEER
IEKGDPYVIRMHVPHGQTEFKDIIHGKVIFNHNVIDDQVLLKSDGYPTYHLANVVDDHMM
KISHEWLSSTPKHLMLYKMLQLDAPEYAHLPLLLNDKGQKLSKRFGDVSVQQYKDKGFLP
EAMINGLALLGWNPPHREDPDVLSQNTSVFLKHEVMNMKDLVATFDLDKVGKSGVKFGQD
KLEFLNSMHIRNKFEYFDQLEAKKATNSWRKMLLDNLPANLHPHIKRVNENKMKKIMDLM
KIRIHFFHDMCNHTYFFTEPDYENIMSEKFAKKLRQPHDVKLKILKELKTKIGKIDDDEF
SPDRVNKECSIYLYENQKSGYKNEDVFFLLRYSMTGNPVGAPVGDILEIIGKQSVMKRFD
LVIEHIQNQIKLEQDKNSASD