Identifiers and Description

Gene Model Identifier

Contig5250.0.g19

Standard Name

DUS1

Aliases

Contig5250_0_g19

Description

Dihydrouridine synthase (Dus)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007235501.0004771100126706e-129dihydrouridine synthase
SGDYML080W5.0014751778710277e-85DUS1 SGDID:S000004545, Chr XII
I from 108806-110077, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5250.0.g19(coding)
ATGGACTCTACTATAGCACAAGCCAACTTGGCAACTTCAAACACTGATTTAAACCTGCAA
CCATCTCAATTGGTTTAAAATTTCACAACAGCCTAGTTAAGAGAGGACCCCTATGCTTAC
TACAGATCAATAGGGTCCCCTAAATTCATAGTGGCACCAATGGTAGACTAATCAGAGTTG
CCTTATCGCATGCTGACTAGGAAGTATAAGGCTCAATTGTGCTATACACCCATGTTTCAT
GGTAGAATGTTTTCTGAAAGTGAAGGTTATAGAAAGGAGTTTTTCTGTCCACATCCAGAG
GATAGACCCTTGAGTGTTCAATTCTGTGCTAATGATCCTTAGGTGTTGTTGAAAGCAGCT
AGATATGTAGAAAATGATTGTGATGCAGTTGATATTAACTTTGGATGTCCTCAGGGAATA
GCCAGGAAAGGGAAATATGGGTCTTTTTTGCTTGAAAAGACTGAAATAATCAGATCGCTC
GTGACAACTCTTGCTCAAAACTTAAAGGTCCCAGTTACTTGTAAGATCAGATGTTTACCA
AATGAAGAAGAAACTATGAAACTAGCCAAAATGATTGAGGAATGTGGTTGTGCCATGCTT
GTGGTACATGGTCGTACAAGAGAGCACAATAAGTAGAGGACTGGACCTGCTAATTGGTAG
ATTATCAAAAAGATTAAGTAAAGTCTTCGTATACCTGTTATAGCTAATGGAGGTATGGCT
ACCTTTGAAGATTGTATGGCTTGTTTAGAATATACTGGATGTGATGGAGTAATGTCCAGC
GAGTCAATTTTGGAATACCCAGCACTGTTTGACCCTCAACCTTCCCTATACAATTTAGAT
GAAATAGCCTTTGAATATTTAGAGATGGTAAAACTGTACCCTGGAGAAGCAGATTTGAAA
AATGTGAGATCTCATATACACAAATTCTTGCATACTGGTTTCAAACAGCATACAGATCTT
AGAGATAAGCTTACTACAAGTAAAACAATGGAGGAATTTAGGGAGATTGTATTGTTAATG
CAGGAACGTAGAAAAGATTTGCCTAATGAGAAGAAAATAGGTTGGTATCACAGATATTGG
GCTTCTGAGAATAAAGTCGCTGGGGAGACAAAAACCTGGATAACTCAAGAGTGGACTGAT
TAAATAGAAAACGATCCTTTATTCAATAAAAGACTGAGAGATTAAGCAGAATCTTAAAAT
AATAACAGAGGGGATTTATGTGTAAAAAATGAAAATATTTTACTTGAGAGTGGAATGGAA
GATTTAAATTTAGGAAATTTCTTGGGTGGAGATGATGCTGACCAATAATAAAATTGA


>Contig5250.0.g19(protein)
MDSTIAQANLATSNTDLNLQPSQLVQNFTTAQLREDPYAYYRSIGSPKFIVAPMVDQSEL
PYRMLTRKYKAQLCYTPMFHGRMFSESEGYRKEFFCPHPEDRPLSVQFCANDPQVLLKAA
RYVENDCDAVDINFGCPQGIARKGKYGSFLLEKTEIIRSLVTTLAQNLKVPVTCKIRCLP
NEEETMKLAKMIEECGCAMLVVHGRTREHNKQRTGPANWQIIKKIKQSLRIPVIANGGMA
TFEDCMACLEYTGCDGVMSSESILEYPALFDPQPSLYNLDEIAFEYLEMVKLYPGEADLK
NVRSHIHKFLHTGFKQHTDLRDKLTTSKTMEEFREIVLLMQERRKDLPNEKKIGWYHRYW
ASENKVAGETKTWITQEWTDQIENDPLFNKRLRDQAESQNNNRGDLCVKNENILLESGME
DLNLGNFLGGDDADQQQN