Identifiers and Description

Gene Model Identifier

Contig1966.0.g90

Standard Name

DUF4

Aliases

Contig1966_0_g90

Description

DNA replication regulator

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12163 ) DNA replication regulator
  • ( pfam12620 ) Protein of unknown function (DUF3778)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1966.0.g90(coding)
ATGCCTTCGCGTTTCTAGTTTGTGGTAAAATTGGAAAAGACTTAGATTAATCGATTCACC
CTTTTACTTCGCTTTAATGACAAGTATAGGTGCGACTCTTGCCCTTTCATTTAGCAACTT
ATAATCATACCCTCTCACAGAATCAGACTTCATTTTACTTTCTCTTTTGTGGAATATGCA
GTTGGATCTAACAAGAAAGCCAAAGTATTTCGCTTCAACATGAGAAAGCTGGGAGATCAG
CTTCTATCAATTATCTTGTTGTTTTCCTATCCTTCGCATTTGATGTGCTTATATTTGGGG
AAACAGTAAAAGGAACAGACATAGCTCAGGCTATCTTCATAATATTCTTTACTCTACTTT
ATGCTGTTTTGTAATGTTAAGAAAATCTGA


>Contig1966.0.g90(protein)
MPSRFQFVVKLEKTQINRFTLLLRFNDKYRCDSCPFIQQLIIIPSHRIRLHFTFSFVEYA
VGSNKKAKVFRFNMRKLGDQLLSIILLFSYPSHLMCLYLGKQQKEQTQLRLSSQYSLLYF
MLFCNVKKI