Identifiers and Description

Gene Model Identifier

Contig21915.0.g51

Standard Name

DUF3

Aliases

Contig21915_0_g51

Description

Protein of unknown function (DUF3464)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001049600.0000899730839127287hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21915.0.g51(coding)
ATGGCTATGTTATCAAAATTAAGAGCAAATTTCCTACTTAAAAATTAAACCTCACAATAT
CACACAAATAGTCTTTTCTTCACTATGAGAAATAGACAATAAAATCCTAAGCCAAAATAA
ACTGAGTTTAAGATTCCAAAGAAAGGGTCACAGGAATATCAATAGATGTTGCAATAGCAA
AAAGGAGAGAAAAAAGAAGCAGCTTAAAAGAAAATCTTTGAGAATCTCACACCCAGATTT
GTATCTGCTATGATTTTCAGTGCAGCAATTCCATAATCAGTGATGCTCTATAGAATGATA
TGGAGTGATCCTTGCTCAGATATATTTTTCCACGCTTTTGAGCAGTCATTTATGTGGATA
GCTTGTTTAAATGCTCTTGAGGGTGCTGCAGCTTGTGGTCTTGGATATATTGACTATAGG
ACTATTGTAGCAAAGGATCCAAAACTTTAATATGATATGAGAAAGAAAAGACTAGCTTTT
GCAAAATTCGCTTTTATTATGGCCATAGCTGGGTTGATTTTAGTTGAGACCCCAACTCCT
AACTGTGTTTTCCCTCTAATTGTTGGGTCAGTATGGAATTCAATAAAATTGGGAACTTAA
ATCAGCTATAACCTTACCCCTGACAAATTTTTCACTGCAAGAACTTTCTTGTCTATGTAT
AACCTTGGGTTCTTGCTTTTGATTTGGTATAAACTCAGACAAGCTAGAAAAGATAAGTTA
GATTTAGAATTCGCTTTCTACAATAGAGTTGAAGGAATTATGTTGAGAATGAGTAATCTT
TTTGATGATGAACAATTTAAGGAAGTCTAATCGTTACAATTAGATATATGA


>Contig21915.0.g51(protein)
MAMLSKLRANFLLKNQTSQYHTNSLFFTMRNRQQNPKPKQTEFKIPKKGSQEYQQMLQQQ
KGEKKEAAQKKIFENLTPRFVSAMIFSAAIPQSVMLYRMIWSDPCSDIFFHAFEQSFMWI
ACLNALEGAAACGLGYIDYRTIVAKDPKLQYDMRKKRLAFAKFAFIMAIAGLILVETPTP
NCVFPLIVGSVWNSIKLGTQISYNLTPDKFFTARTFLSMYNLGFLLLIWYKLRQARKDKL
DLEFAFYNRVEGIMLRMSNLFDDEQFKEVQSLQLDI