Identifiers and Description

Gene Model Identifier

Contig19.1.g90

Standard Name

DUF2

Aliases

Contig19_1_g90

Description

Protein of unknown function (DUF3816)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam12822 ) Protein of unknown function (DUF3816)
  • ( pfam13903 ) PMP-22/EMP/MP20/Claudin tight junction
  • ( pfam06421 ) GTP-binding protein LepA C-terminus
  • ( pfam08408 ) DNA polymerase family B viral insert
  • ( pfam03631 ) Virulence factor BrkB
  • ( pfam11026 ) Protein of unknown function (DUF2721)
  • ( pfam12351 ) Ca2+ regulator and membrane fusion protein Fig1
  • ( pfam11712 ) Endoplasmic reticulum-based factor for assembly of V-ATPase

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19.1.g90(coding)
ATGGATGCAAGATTGCCTTTTGTGAATGGTGGAATAAGCATGCAATATCAAAATGATCCT
AATAATTTTGAATATGCTCAGCCTGGACAGTATGGAGGAGGTCTGTTTCAACCAGGATAG
CAGGATGATTATGATGATGGTGGCAACAATGAAAGTGGATTCAGATTTGATGAACCTGTT
ACTCCTACCAGACAATCAAACATACCTTTCAAAAGAGAGCTGAATCAAAGTCCAAATAAA
ACAGGGGGTCAAATTAAATTGAACGATTTAGCTTAAGAAGATATTTCAAACGAGCCTTAC
ATCGGTAGAGATGCAGTCGTTGTTATAGAGGGAGAAATGAGACAATTCGATGGAAAACGC
CTTGATAAAATTTAGAGGTATGTTGAGTCTCTTGTAACTGGTAACTTTATGGCAGTAAAG
AAAGACATTAACTTGTAAATCTAAGCAGCGGACATCAATGATAAAACAAAGCAATTAAAA
TCAAACAGAGAGCAAATGGAGAAAGAAATGAAGGAGATTTAAAAGGTGTGGGTGAACAGA
GTAAACAAACTTTTCAACATGTTTTTGGGTTTACTAGCTGGTATGTCTGCTATGCACTTA
ATAGTTATCTTGAGCTAAAATGATAGAGGTTCTTTCCTTCAGCTGTACTCTAAAATCAGC
ACAATAGTTAATATAGTGTTTATGGTATTCACAAGTTTCTGCTTGATTCTTGGATTATCA
CTTACTCTTATCTACAAATAAAAATCCGATGAAAAGATGAGAAATATGGATGAATTCAGA
TTAGAATTCAGACAGCATTATATTGTAAGCGCAGTAATGACTGCCATAGTTGCTTTCTGT
TTACTTTTACTCTATATTCTGCCAACATTTACAAACAAAATTTACTATTGGAACCCTGTC
AATGTTTCTGATAGCGACATACTAAAATGTAAAGGTCTTTTTGCAGCAGTTAATGTGTTT
TTTATTATCGCCTGGTTAATGGCAAGTGCCTTCAATAAAGCTTCAATTTCAGATCTTGAT
ATGGACCCTGAAGAAATGAATGACGATTAAAACTAAGATGACACTCAAGATTCTGATTGA


>Contig19.1.g90(protein)
MDARLPFVNGGISMQYQNDPNNFEYAQPGQYGGGLFQPGQQDDYDDGGNNESGFRFDEPV
TPTRQSNIPFKRELNQSPNKTGGQIKLNDLAQEDISNEPYIGRDAVVVIEGEMRQFDGKR
LDKIQRYVESLVTGNFMAVKKDINLQIQAADINDKTKQLKSNREQMEKEMKEIQKVWVNR
VNKLFNMFLGLLAGMSAMHLIVILSQNDRGSFLQLYSKISTIVNIVFMVFTSFCLILGLS
LTLIYKQKSDEKMRNMDEFRLEFRQHYIVSAVMTAIVAFCLLLLYILPTFTNKIYYWNPV
NVSDSDILKCKGLFAAVNVFFIIAWLMASAFNKASISDLDMDPEEMNDDQNQDDTQDSD