Identifiers and Description

Gene Model Identifier

Contig5714.0.g9

Standard Name

DUF1

Aliases

Contig5714_0_g9

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010805007.000924640675686e-24Helicase conserved C-terminal
domain containi...
SGDYOR290C0.000050024383570459175SNF2 SGDID:S000005816, Chr XV
from 860258-855147, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5714.0.g9(coding)
ATGGTCCGACCAGACATAATGCCTTCCTTCCATGAATTTGGCTATAGATATTGTGATCCT
CGACAATCATTTGATGGTATTGATTTTTCAAATGCAGGGAATATGATTGAGTTGAAGCAA
TTGTTAGACAAGAGAATTCAAACAATTTTCAAGCGAAAGTATGTTTTCAATGAACTCCCA
GATATTGTGAGACAAAAACTTGAAGTGCACTGTGAAACATCCATAATTGTTAAAATGCAA
TAGCTTTTGCTAAACTATGTAGTACCACGAGAAGTACAGAATCCTGATTTAAGCTTTTTC
GAAGAAATGTTCTTGACCTACTTTCAAACACCAGATAAAGTTTAATCGAAATTTTTATGT
GACCCAATAGATGATAGTAAATTGAGCTTCTAGAAAAGCTTAGTTTAGATATTCAGGGAT
CTATATGATTACTCTGGTTAAGCCAAACTTAAAGCAACTTATGAAGTCATTGATAATATT
TTGGAGAATGGAATGAGAGTGCTGATATTTGGCTACCACCTGTATTTTATAACTGCAATT
GAAGATCATTTGACCAGCAAGGTCAAATTTTTATATTTGGGTAAGAATGTCGATACCGAT
TACAAATAAGATATTTGCTAAAAGTTTAACGAAGACGATTCGTACAAAGCGGTTCTTATT
GATTTAAGCGAAGATTTGTCAGATATTCAGTTTCTGACGCCAAATACAGTGATATTATTT
GCTGAAACGTTTTGGAATTGGGACTATATGGAGAAAGCAGAGAGTTTAATTGTTACGCCA
GGCATGAAGTCAGCAAATAATGTAATCTATCTTTTTGGGAGATACACTCTTGATGAGTAC
ATTTTCAAGCTTTTGTACAGACAAAATAATGAACTTTATTAATAACTTGAGCCGCTGCAA
CTTGACTTAGATGATTTCAGAATAAAAGAAAACCTTGGCCAAAACTACGATGAGTTAAAA
TGTACTCAAATAAATTGGAACTCTCAATCATTCTAAACATTCTCACAAATTACTGAATAG
CCATGCAACGATCAAAATTTAGACATAAGTAATATAGATCCCTTAGCCCCTGCAAAGATT
TTTCAAAAGGGTGGTTCAATGACGCTTGATAATATGTTTTTGAAGTAACGCATAGAAAAT
TAGCACTAAGAAATGATAAACCAAAACTCAAGCAAAATTAAAAAGTAAAATAATGTAAGT
CATAATTCAGATGATAGCTAATAATCTGATGTGAACGAGGATGACTTGGCATCTGTAATG
ACTCAACAAAAACATTAAAATAATAATGATTAGAAATTAAATAAAAGCGCTTTAGAAGAC
ATGAAGGATGAAGACCTCATGATGTTTTTAGAAATGTGA


>Contig5714.0.g9(protein)
MVRPDIMPSFHEFGYRYCDPRQSFDGIDFSNAGNMIELKQLLDKRIQTIFKRKYVFNELP
DIVRQKLEVHCETSIIVKMQQLLLNYVVPREVQNPDLSFFEEMFLTYFQTPDKVQSKFLC
DPIDDSKLSFQKSLVQIFRDLYDYSGQAKLKATYEVIDNILENGMRVLIFGYHLYFITAI
EDHLTSKVKFLYLGKNVDTDYKQDICQKFNEDDSYKAVLIDLSEDLSDIQFLTPNTVILF
AETFWNWDYMEKAESLIVTPGMKSANNVIYLFGRYTLDEYIFKLLYRQNNELYQQLEPLQ
LDLDDFRIKENLGQNYDELKCTQINWNSQSFQTFSQITEQPCNDQNLDISNIDPLAPAKI
FQKGGSMTLDNMFLKQRIENQHQEMINQNSSKIKKQNNVSHNSDDSQQSDVNEDDLASVM
TQQKHQNNNDQKLNKSALEDMKDEDLMMFLEM