Identifiers and Description

Gene Model Identifier

Contig14211.0.g46

Standard Name

DTD1a

Aliases

Contig14211_0_g46

Description

D-Tyr-tRNA(Tyr) deacylase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006243104.001118334825066e-42D-tyrosyl-tRNA(Tyr) deacylase
SGDYDL219W8.997017754360629e-34DTD1 SGDID:S000002378, Chr IV
from 65242-65306,65378-65...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14211.0.g46(coding)
ATGAGAATTGTGATACAGCGTGTTTTAAGAGCTTAGTTAACTTCCAATGAGCAAGTTGTC
TCAACCATAAACAAGGGGCTAATGGTTTTAGTAGGAATCACACACACAGACAATTACATG
GACTATGAGTACCTAGCAAAGAAAATTCTCAATCTCAAGCTCTGGCCTGACATCAAAGAT
CCTAATAAAGCTTGGGGCTCAAATGTAATTGAGAACAAATTCGATATACTGTTGGTGTCT
CAATTCACACTCTATCATCAACTTAAGGGCACTAAGCCAGACTTTCATGATGCCATGAAC
GGGGAGAAAGCTCAACTTTTATACAATGAGTTTTTGGAATATCTAAGGAAACAGTATGAA
GCGGAGAGAGTACAGCCTGGTGCCTTTGGTCAATACATGAATATAGAAATGGTCTGCGAT
GGGCCTGTTACAATCACTGTAGAAAGCTAAAAAGATGAGAAAGCTTTAAAGAAGCTTGAA
GCTCTGGAGAAGCGAAAGCTAAAAGGAGCAGCTTAGAGCAACAATCAAACTGTTAATGGC
TAGAAAGAACAAATTTAGTCATCTATGGAGAGTTAAGATCAAAGTCAGTAACTAGCCGAT
TAAAATATGCAAAGTCAGAATAGCCAGATTAGCTAAGAAGAGAGCAAGATAAGCATATAA
GAAGAGGAAGAGAAGAAATCTTAGTGA


>Contig14211.0.g46(protein)
MRIVIQRVLRAQLTSNEQVVSTINKGLMVLVGITHTDNYMDYEYLAKKILNLKLWPDIKD
PNKAWGSNVIENKFDILLVSQFTLYHQLKGTKPDFHDAMNGEKAQLLYNEFLEYLRKQYE
AERVQPGAFGQYMNIEMVCDGPVTITVESQKDEKALKKLEALEKRKLKGAAQSNNQTVNG
QKEQIQSSMESQDQSQQLADQNMQSQNSQISQEESKISIQEEEEKKSQ